F302810

General Info

Members Datasets Scaffolds Average Seq Length
197 144 394 135

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1152588|Ga0081540_11525882
Length 138
Sequence MTTRSRKYLYGAAIRMSEERARQARKEADRLACEAWNKRMLGYKGPAQPSPMLGDALNAGYCYLEVRCLGCDTHQTVALGIVRRPKATTPIHELERYMRCKNCSELQGRPFKRSHLVALRPTKISATHPASVWWPGER

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
137 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
138 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
139 2922368715
140 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
141 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
142 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
143 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
144 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.41
Metatranscriptomes 0
Isolates 4.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.06
Nodule 4.06
Rhizoplane 2.54
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1152588 3300005983 Bacteria 909
2 JGI25406J46586_10000096 3300003203 Bacteria 39663
3 Ga0070683_100014558 3300005329 Bacteria 6886
4 Ga0070675_100756061 3300005354 Bacteria 887
5 Ga0070709_10644496 3300005434 Bacteria 820
6 Ga0070714_100443195 3300005435 Bacteria 1233
7 Ga0070713_100593660 3300005436 Bacteria 1052
8 Ga0070711_100452201 3300005439 Bacteria 1051
9 Ga0070681_10014525 3300005458 Bacteria 7837
10 Ga0070681_11923064 3300005458 Bacteria 519
11 Ga0070707_100115060 3300005468 Bacteria 2610
12 Ga0070707_100185667 3300005468 Bacteria 2027
13 Ga0070698_100066815 3300005471 Bacteria 3617
14 Ga0070679_100015371 3300005530 Bacteria 7354
15 Ga0070679_100307595 3300005530 Bacteria 1535
16 Ga0070684_100039577 3300005535 Bacteria 4056
17 Ga0070697_100066581 3300005536 Bacteria 2945
18 Ga0068853_100025970 3300005539 Bacteria 4916
19 Ga0070665_100482175 3300005548 Bacteria 1251
20 Ga0070665_101271617 3300005548 Bacteria 746
21 Ga0068855_100060312 3300005563 Bacteria 4437
22 Ga0068857_100005772 3300005577 Bacteria 10583
23 Ga0068857_100006113 3300005577 Bacteria 10281
24 Ga0068857_100117512 3300005577 Bacteria 2393
25 Ga0068854_100005743 3300005578 Bacteria 7848
26 Ga0068856_100001523 3300005614 Bacteria 24309
27 Ga0068856_100007940 3300005614 Bacteria 10361
28 Ga0068851_10129897 3300005834 Bacteria 1361
29 Ga0068863_101177565 3300005841 Bacteria 772
30 Ga0068858_100071999 3300005842 Bacteria 3207
31 Ga0081540_1004195 3300005983 Bacteria 11083
32 Ga0081539_10000051 3300005985 Bacteria 268337
33 Ga0075365_10604158 3300006038 Bacteria 776
34 Ga0075368_10077048 3300006042 Bacteria 1353
35 Ga0075363_100391139 3300006048 Bacteria 816
36 Ga0070715_10147497 3300006163 Bacteria 1149
37 Ga0070716_100023661 3300006173 Bacteria 3259
38 Ga0070716_100280776 3300006173 Bacteria 1149
39 Ga0070716_100687373 3300006173 Bacteria 780
40 Ga0070712_100036180 3300006175 Bacteria 3357
41 Ga0070712_100272900 3300006175 Bacteria 1359
42 Ga0070712_100702580 3300006175 Bacteria 862
43 Ga0075367_10435672 3300006178 Bacteria 830
44 Ga0075428_100405907 3300006844 Bacteria 1460
45 Ga0099795_10106526 3300007788 Bacteria 1106
46 Ga0105240_10008280 3300009093 Bacteria 14884
47 Ga0105240_10120313 3300009093 Bacteria 3162
48 Ga0105247_11082910 3300009101 Bacteria 631
49 Ga0105241_10001592 3300009174 Bacteria 17356
50 Ga0105241_10019795 3300009174 Bacteria 4967
51 Ga0105248_10061780 3300009177 Bacteria 4207
52 Ga0105248_10131443 3300009177 Bacteria 2824
53 Ga0105248_12413124 3300009177 Bacteria 599
54 Ga0105237_10308029 3300009545 Bacteria 1586
55 Ga0105237_10336223 3300009545 Bacteria 1514
56 Ga0105238_10000816 3300009551 Bacteria 32325
57 Ga0105238_10002016 3300009551 Bacteria 20491
58 Ga0105238_10063608 3300009551 Bacteria 3690
59 Ga0105238_10249208 3300009551 Bacteria 1754
60 Ga0105239_10002547 3300010375 Bacteria 23135
61 Ga0105239_10018330 3300010375 Bacteria 7739
62 Ga0105239_10019989 3300010375 Bacteria 7391
63 Ga0105239_10263083 3300010375 Bacteria 1939
64 Ga0157373_10792244 3300013100 Bacteria 699
65 Ga0157369_10061434 3300013105 Bacteria 4051
66 Ga0163162_10660155 3300013306 Bacteria 1169
67 Ga0157375_10107841 3300013308 Bacteria 2879
68 Ga0157379_11852833 3300014968 Bacteria 594
69 Ga0213874_10022574 3300021377 Bacteria 1748
70 Ga0213876_10045060 3300021384 Bacteria 2333
71 Ga0213871_10026027 3300021441 Bacteria 1493
72 Ga0207692_10046668 3300025898 Bacteria 2172
73 Ga0207688_10562725 3300025901 Bacteria 717
74 Ga0207647_10018228 3300025904 Bacteria 4756
75 Ga0207685_10029063 3300025905 Bacteria 1953
76 Ga0207685_10189632 3300025905 Bacteria 959
77 Ga0207699_10124956 3300025906 Bacteria 1669
78 Ga0207654_10000927 3300025911 Bacteria 16209
79 Ga0207654_10002856 3300025911 Bacteria 8762
80 Ga0207707_10035778 3300025912 Bacteria 4342
81 Ga0207695_10088900 3300025913 Bacteria 3108
82 Ga0207695_10199296 3300025913 Bacteria 1917
83 Ga0207671_10595828 3300025914 Bacteria 881
84 Ga0207693_10051176 3300025915 Bacteria 3242
85 Ga0207693_10076316 3300025915 Bacteria 2625
86 Ga0207660_10131517 3300025917 Bacteria 1905
87 Ga0207657_10601133 3300025919 Bacteria 858
88 Ga0207694_10000212 3300025924 Bacteria 56506
89 Ga0207694_10258775 3300025924 Bacteria 1425
90 Ga0207694_10468350 3300025924 Bacteria 1053
91 Ga0207700_10202099 3300025928 Bacteria 1675
92 Ga0207664_10504984 3300025929 Bacteria 1083
93 Ga0207644_10178701 3300025931 Bacteria 1662
94 Ga0207670_10511908 3300025936 Bacteria 976
95 Ga0207665_10252452 3300025939 Bacteria 1304
96 Ga0207665_10796100 3300025939 Bacteria 747
97 Ga0207711_10331847 3300025941 Bacteria 1407
98 Ga0207661_10091885 3300025944 Bacteria 2529
99 Ga0207667_10037294 3300025949 Bacteria 5196
100 Ga0207640_10003719 3300025981 Bacteria 8226
101 Ga0207703_10369203 3300026035 Bacteria 1325
102 Ga0207639_10086330 3300026041 Bacteria 2498
103 Ga0207639_10382499 3300026041 Bacteria 1264
104 Ga0207678_10138729 3300026067 Bacteria 2075
105 Ga0207678_10279335 3300026067 Bacteria 1433
106 Ga0207702_10000003 3300026078 Bacteria 434196
107 Ga0207702_10000093 3300026078 Bacteria 103678
108 Ga0207702_10097639 3300026078 Bacteria 2586
109 Ga0207641_10528085 3300026088 Bacteria 1149
110 Ga0207674_10006204 3300026116 Bacteria 14085
111 Ga0207674_10008379 3300026116 Bacteria 11956
112 Ga0207683_10222121 3300026121 Bacteria 1721
113 Ga0268266_10349201 3300028379 Bacteria 1390
114 Ga0307515_10626422 3300028794 Bacteria 687
115 Ga0373944_0344979 3300035089 Bacteria 566
116 Ga0373954_0180856 3300035118 Bacteria 1034
117 Ga0373924_0294986 3300035410 Bacteria 720
118 Ga0373935_0927029 3300035692 Bacteria 646
119 Ga0373933_0265175 3300035724 Bacteria 1108
120 Ga0373933_0344171 3300035724 Bacteria 968
121 Ga0373947_0650737 3300035725 Bacteria 719
122 Ga0373937_0074839 3300036401 Bacteria 3126
123 Ga0373937_0347690 3300036401 Bacteria 1404
124 Ga0373925_0268579 3300037068 Bacteria 1372
125 Ga0395900_0320683 3300037418 Bacteria 1530
126 Ga0436365_0498754 3300039437 Bacteria 1228
127 Ga0436365_0508416 3300039437 Bacteria 2333
128 Ga0436365_0977636 3300039437 Bacteria 1019
129 Ga0436360_1315174 3300039438 Bacteria 2987
130 Ga0436361_0380036 3300039447 Bacteria 2188
131 Ga0436362_1191202 3300039453 Bacteria 2638
132 Ga0451791_0603375 3300041451 Bacteria 696
133 Ga0451853_0663473 3300041512 Bacteria 609
134 Ga0466959_0122050 3300045049 Bacteria 1852
135 Ga0466967_0021535 3300045976 Bacteria 5240
136 Ga0495651_0128815 3300046462 Bacteria 1850
137 Ga0495651_0255501 3300046462 Bacteria 1195
138 Ga0495651_0395704 3300046462 Bacteria 903
139 Ga0495582_0294515 3300046473 Bacteria 933
140 Ga0495618_0321014 3300046514 Bacteria 959
141 Ga0495632_0089419 3300046519 Bacteria 1462
142 Ga0495587_0024312 3300046536 Bacteria 3715
143 Ga0495587_0068362 3300046536 Bacteria 2069
144 Ga0495667_0168832 3300046559 Bacteria 1406
145 Ga0495656_0806066 3300046615 Bacteria 507
146 Ga0495668_0208381 3300046616 Bacteria 1070
147 Ga0495668_0662398 3300046616 Bacteria 577
148 Ga0495611_0077254 3300046648 Bacteria 1527
149 Ga0495625_0402567 3300046660 Bacteria 855
150 Ga0495635_0512539 3300046663 Bacteria 789
151 Ga0495659_0051036 3300046664 Bacteria 1506
152 Ga0495657_0183045 3300046675 Bacteria 1284
153 Ga0495623_0042945 3300046679 Bacteria 2878
154 Ga0495623_0303094 3300046679 Bacteria 882
155 Ga0495646_0080589 3300046680 Bacteria 1898
156 Ga0495646_0410555 3300046680 Bacteria 703
157 Ga0495647_0533555 3300046681 Bacteria 548
158 Ga0495589_0275946 3300046794 Bacteria 782
159 Ga0495589_0280538 3300046794 Bacteria 775
160 Ga0495600_0600833 3300046809 Bacteria 668
161 Ga0495604_0232146 3300047317 Bacteria 1265
162 Ga0495674_1180959 3300047319 Bacteria 579
163 Ga0495680_0351869 3300047322 Bacteria 1025
164 Ga0495675_0364657 3300047444 Bacteria 847
165 Ga0495681_0186661 3300047470 Bacteria 849
166 Ga0495686_0587808 3300047472 Bacteria 578
167 Ga0495686_0651346 3300047472 Bacteria 541
168 Ga0495602_0756891 3300048088 Bacteria 655
169 Ga0496100_0982594 3300048903 Bacteria 664
170 Ga0496106_1528279 3300048909 Bacteria 513
171 Ga0496108_0714659 3300048911 Bacteria 868
172 Ga0496109_1871491 3300048912 Bacteria 533
173 Ga0496118_0599871 3300048921 Bacteria 527
174 Ga0496125_0003135 3300048928 Bacteria 20522
175 Ga0496125_0096197 3300048928 Bacteria 2199
176 Ga0496125_0120467 3300048928 Bacteria 1873
177 Ga0496126_0102445 3300048929 Bacteria 2503
178 Ga0496126_1086905 3300048929 Bacteria 595
179 nmdc:mga03n38_563220_c1 3300050490 Bacteria 646
180 nmdc:mga0k408_774025_c1 3300050493 Bacteria 560
181 Ga0495601_0028234 3300053077 Bacteria 3474
182 Ga0495595_0023641 3300053084 Bacteria 2708
183 Ga0495595_0182701 3300053084 Bacteria 1040
184 Ga0495619_0020060 3300053085 Bacteria 4254
185 Ga0495619_0466233 3300053085 Bacteria 870
186 Ga0500556_0000438 3300053104 Bacteria 29796
187 Ga0500568_0127893 3300053139 Bacteria 945
188 2509154533 2508501128 Bacteria 8613869
189 2513673263 2513237098 Bacteria 9902361
190 2513678007 2513237098 Bacteria 9902361
191 2903770042 2903768456 Bacteria 9749579
192 2922369030
193 2935620648 2935616580 Bacteria 9032984
194 2935858456 2935855204 Bacteria 9035059
195 2935867123 2935864058 Bacteria 9784707
196 2935877253 2935873716 Bacteria 9632195
197 8006977045 8006973647 Bacteria 10679141
198 Ga0081540_1152588
199 JGI25406J46586_10000096
200 Ga0070683_100014558
201 Ga0070675_100756061
202 Ga0070709_10644496
203 Ga0070714_100443195
204 Ga0070713_100593660
205 Ga0070711_100452201
206 Ga0070681_10014525
207 Ga0070681_11923064
208 Ga0070707_100115060
209 Ga0070707_100185667
210 Ga0070698_100066815
211 Ga0070679_100015371
212 Ga0070679_100307595
213 Ga0070684_100039577
214 Ga0070697_100066581
215 Ga0068853_100025970
216 Ga0070665_100482175
217 Ga0070665_101271617
218 Ga0068855_100060312
219 Ga0068857_100005772
220 Ga0068857_100006113
221 Ga0068857_100117512
222 Ga0068854_100005743
223 Ga0068856_100001523
224 Ga0068856_100007940
225 Ga0068851_10129897
226 Ga0068863_101177565
227 Ga0068858_100071999
228 Ga0081540_1004195
229 Ga0081539_10000051
230 Ga0075365_10604158
231 Ga0075368_10077048
232 Ga0075363_100391139
233 Ga0070715_10147497
234 Ga0070716_100023661
235 Ga0070716_100280776
236 Ga0070716_100687373
237 Ga0070712_100036180
238 Ga0070712_100272900
239 Ga0070712_100702580
240 Ga0075367_10435672
241 Ga0075428_100405907
242 Ga0099795_10106526
243 Ga0105240_10008280
244 Ga0105240_10120313
245 Ga0105247_11082910
246 Ga0105241_10001592
247 Ga0105241_10019795
248 Ga0105248_10061780
249 Ga0105248_10131443
250 Ga0105248_12413124
251 Ga0105237_10308029
252 Ga0105237_10336223
253 Ga0105238_10000816
254 Ga0105238_10002016
255 Ga0105238_10063608
256 Ga0105238_10249208
257 Ga0105239_10002547
258 Ga0105239_10018330
259 Ga0105239_10019989
260 Ga0105239_10263083
261 Ga0157373_10792244
262 Ga0157369_10061434
263 Ga0163162_10660155
264 Ga0157375_10107841
265 Ga0157379_11852833
266 Ga0213874_10022574
267 Ga0213876_10045060
268 Ga0213871_10026027
269 Ga0207692_10046668
270 Ga0207688_10562725
271 Ga0207647_10018228
272 Ga0207685_10029063
273 Ga0207685_10189632
274 Ga0207699_10124956
275 Ga0207654_10000927
276 Ga0207654_10002856
277 Ga0207707_10035778
278 Ga0207695_10088900
279 Ga0207695_10199296
280 Ga0207671_10595828
281 Ga0207693_10051176
282 Ga0207693_10076316
283 Ga0207660_10131517
284 Ga0207657_10601133
285 Ga0207694_10000212
286 Ga0207694_10258775
287 Ga0207694_10468350
288 Ga0207700_10202099
289 Ga0207664_10504984
290 Ga0207644_10178701
291 Ga0207670_10511908
292 Ga0207665_10252452
293 Ga0207665_10796100
294 Ga0207711_10331847
295 Ga0207661_10091885
296 Ga0207667_10037294
297 Ga0207640_10003719
298 Ga0207703_10369203
299 Ga0207639_10086330
300 Ga0207639_10382499
301 Ga0207678_10138729
302 Ga0207678_10279335
303 Ga0207702_10000003
304 Ga0207702_10000093
305 Ga0207702_10097639
306 Ga0207641_10528085
307 Ga0207674_10006204
308 Ga0207674_10008379
309 Ga0207683_10222121
310 Ga0268266_10349201
311 Ga0307515_10626422
312 Ga0373944_0344979
313 Ga0373954_0180856
314 Ga0373924_0294986
315 Ga0373935_0927029
316 Ga0373933_0265175
317 Ga0373933_0344171
318 Ga0373947_0650737
319 Ga0373937_0074839
320 Ga0373937_0347690
321 Ga0373925_0268579
322 Ga0395900_0320683
323 Ga0436365_0498754
324 Ga0436365_0508416
325 Ga0436365_0977636
326 Ga0436360_1315174
327 Ga0436361_0380036
328 Ga0436362_1191202
329 Ga0451791_0603375
330 Ga0451853_0663473
331 Ga0466959_0122050
332 Ga0466967_0021535
333 Ga0495651_0128815
334 Ga0495651_0255501
335 Ga0495651_0395704
336 Ga0495582_0294515
337 Ga0495618_0321014
338 Ga0495632_0089419
339 Ga0495587_0024312
340 Ga0495587_0068362
341 Ga0495667_0168832
342 Ga0495656_0806066
343 Ga0495668_0208381
344 Ga0495668_0662398
345 Ga0495611_0077254
346 Ga0495625_0402567
347 Ga0495635_0512539
348 Ga0495659_0051036
349 Ga0495657_0183045
350 Ga0495623_0042945
351 Ga0495623_0303094
352 Ga0495646_0080589
353 Ga0495646_0410555
354 Ga0495647_0533555
355 Ga0495589_0275946
356 Ga0495589_0280538
357 Ga0495600_0600833
358 Ga0495604_0232146
359 Ga0495674_1180959
360 Ga0495680_0351869
361 Ga0495675_0364657
362 Ga0495681_0186661
363 Ga0495686_0587808
364 Ga0495686_0651346
365 Ga0495602_0756891
366 Ga0496100_0982594
367 Ga0496106_1528279
368 Ga0496108_0714659
369 Ga0496109_1871491
370 Ga0496118_0599871
371 Ga0496125_0003135
372 Ga0496125_0096197
373 Ga0496125_0120467
374 Ga0496126_0102445
375 Ga0496126_1086905
376 nmdc:mga03n38_563220_c1
377 nmdc:mga0k408_774025_c1
378 Ga0495601_0028234
379 Ga0495595_0023641
380 Ga0495595_0182701
381 Ga0495619_0020060
382 Ga0495619_0466233
383 Ga0500556_0000438
384 Ga0500568_0127893
385 2509154533
386 2513673263
387 2513678007
388 2903770042
389 2922369030
390 2935620648
391 2935858456
392 2935867123
393 2935877253
394 8006977045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uxy-assembly1.cif.gz_A murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine 0.6828 61 118
2q85-assembly1.cif.gz_A crystal structure of e. coli mur b bound to a naphthyl tetronic acid inihibitor 0.6754 61 118
7aju-assembly1.cif.gz_Db cryo-em structure of the 90s-exosome super-complex (state post-a1-exosome) 0.6614 61 78
3gnf-assembly1.cif.gz_B p1 crystal structure of the n-terminal r1-r7 of murine mvp 0.6513 60 78
7w7p-assembly1.cif.gz_B cryo-em structure of gmcm8/9 helicase 0.6503 61 85
ID Description Score Start End Superfamily
af_I1MWK2_272_308_2.20.28.10 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7299 63 115 2.20.28.10
af_A2ARH1_204_244_2.20.28.10 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.704 63 115 2.20.28.10
af_E7F643_222_377_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6918 61 85 2.40.50.140
af_Q9VMD4_382_428_2.20.28.10 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.6799 63 78 2.20.28.10
af_I1MWK2_272_308_2.20.28.10 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.6678 63 115 2.20.28.10
ID Description Score Start End GO Terms
AF-A0A1I7MD55-F1-model_v4 deleted 0.9548 19 137
AF-A0A1N6JT55-F1-model_v4 deleted 0.9365 1 137
AF-A0A1H0HMT1-F1-model_v4 Recombination endonuclease VII 0.9297 1 137
AF-A0A1N6IHS5-F1-model_v4 deleted 0.9262 38 137
AF-A0A1H4RZB9-F1-model_v4 Uncharacterized protein 0.9213 1 131

Map