F302716

General Info

Members Datasets Scaffolds Average Seq Length
197 132 190 262

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100012294|Ga0070699_1000122946
Length 274
Sequence MSDSVLPGDAGSGASSGAIAGHGRALREDGWTLLPSLVPAAFVTRLAQELDAAYRDQRALQLRNGVGDGADGTVHHLPCAGGAFLELLEEDHGQTLLGQFFQGAYILNTFGGVLNLPSEASYVGRVHRDQRTFSGDLHLMVQLLVMLDDFTEDNGATYLLSGSHRMRERPPDDVFFRDAARAVGCAGSIAVFDSNLWHAAGVNRSDRPRRALTLAFTRPFIKQQLDYARALGYDRGDRFSPALRQLLGYNARVPVSLDEWYQPPEKRMYKRGQG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
132 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 1.52
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2449184 2162886007 Bacteria 40848
2 SwRhRL2b_contig_41667 2162886007 Bacteria 3169
3 JGI24736J21556_1000330 3300001904 Bacteria 8852
4 JGI24739J22299_10001285 3300001989 Bacteria 9443
5 JGI24739J22299_10001294 3300001989 Bacteria 9405
6 JGI24737J22298_10000149 3300001990 Bacteria 21865
7 JGI24737J22298_10009072 3300001990 Bacteria 3316
8 JGI24737J22298_10009428 3300001990 Bacteria 3248
9 JGI24735J21928_10000014 3300002067 Bacteria 186670
10 JGI24735J21928_10003511 3300002067 Bacteria 5343
11 JGI25164J39214_1000894 3300002772 Bacteria 10034
12 JGI25165J46597_1002140 3300003214 Bacteria 7098
13 rootL2_10081237 3300003322 Bacteria 10612
14 Ga0065165_1006147 3300005262 Bacteria 6418
15 Ga0065714_10002986 3300005288 Bacteria 10791
16 Ga0065714_10009071 3300005288 Bacteria 2398
17 Ga0065714_10087275 3300005288 Bacteria 2059
18 Ga0065704_10000223 3300005289 Bacteria 110188
19 Ga0070683_100013913 3300005329 Bacteria 7028
20 Ga0070683_100337302 3300005329 Bacteria 1435
21 Ga0070690_100116306 3300005330 Bacteria 1790
22 Ga0068868_100071007 3300005338 Bacteria 2777
23 Ga0068868_100283787 3300005338 Bacteria 1402
24 Ga0068868_100556880 3300005338 Unclassified 1011
25 Ga0070675_100005710 3300005354 Bacteria 9520
26 Ga0070673_100499870 3300005364 Bacteria 1100
27 Ga0070659_100014622 3300005366 Bacteria 5868
28 Ga0070708_100170407 3300005445 Bacteria 2032
29 Ga0070678_100054490 3300005456 Bacteria 2914
30 Ga0068867_100104923 3300005459 Bacteria 2163
31 Ga0070706_100313110 3300005467 Unclassified 1464
32 Ga0070707_100063282 3300005468 Bacteria 3551
33 Ga0070699_100012294 3300005518 Bacteria 7385
34 Ga0070684_100102166 3300005535 Bacteria 2563
35 Ga0070697_100122426 3300005536 Bacteria 2177
36 Ga0070697_100296327 3300005536 Bacteria 1390
37 Ga0070686_100160029 3300005544 Unclassified 1585
38 Ga0070665_100004133 3300005548 Bacteria 15268
39 Ga0070704_100192537 3300005549 Bacteria 1640
40 Ga0068855_100154775 3300005563 Bacteria 2605
41 Ga0068855_100240081 3300005563 Bacteria 2025
42 Ga0068857_100281331 3300005577 Bacteria 1530
43 Ga0068856_100367042 3300005614 Bacteria 1458
44 Ga0068858_100017641 3300005842 Bacteria 6691
45 Ga0068858_100181074 3300005842 Bacteria 1990
46 Ga0068860_100190340 3300005843 Bacteria 1985
47 Ga0068860_100382791 3300005843 Bacteria 1389
48 Ga0068862_100273371 3300005844 Bacteria 1546
49 Ga0070717_10053014 3300006028 Bacteria 3343
50 Ga0097621_100017911 3300006237 Bacteria 5394
51 Ga0097621_100298926 3300006237 Bacteria 1421
52 Ga0097621_100523633 3300006237 Bacteria 1076
53 Ga0068871_100001784 3300006358 Bacteria 14502
54 Ga0075428_100395933 3300006844 Bacteria 1480
55 Ga0075431_100032966 3300006847 Bacteria 5338
56 Ga0075433_10255776 3300006852 Bacteria 1553
57 Ga0075433_10363941 3300006852 Bacteria 1277
58 Ga0075434_100000001 3300006871 Bacteria 160353
59 Ga0075434_100082848 3300006871 Bacteria 3205
60 Ga0075434_100260126 3300006871 Bacteria 1754
61 Ga0075434_100388846 3300006871 Bacteria 1416
62 Ga0068865_100021965 3300006881 Bacteria 4155
63 Ga0068865_100025291 3300006881 Bacteria 3903
64 Ga0075436_100000127 3300006914 Bacteria 45376
65 Ga0075436_100029263 3300006914 Bacteria 3788
66 Ga0075436_100038421 3300006914 Bacteria 3304
67 Ga0075435_100000007 3300007076 Bacteria 118665
68 Ga0075435_100008705 3300007076 Bacteria 7301
69 Ga0075435_100017806 3300007076 Bacteria 5385
70 Ga0075435_100325974 3300007076 Bacteria 1315
71 Ga0105240_10039382 3300009093 Bacteria 6053
72 Ga0105240_10369633 3300009093 Bacteria 1622
73 Ga0105245_10012881 3300009098 Bacteria 7289
74 Ga0105247_10023993 3300009101 Bacteria 3674
75 Ga0114129_10013857 3300009147 Bacteria 11488
76 Ga0105241_10201119 3300009174 Bacteria 1664
77 Ga0105242_10043592 3300009176 Bacteria 3629
78 Ga0105248_10038806 3300009177 Bacteria 5331
79 Ga0105248_10157925 3300009177 Bacteria 2559
80 Ga0105237_10007963 3300009545 Bacteria 11545
81 Ga0105237_10020332 3300009545 Bacteria 6847
82 Ga0105238_10025060 3300009551 Bacteria 6080
83 Ga0105249_10450009 3300009553 Bacteria 1326
84 Ga0105239_10001169 3300010375 Bacteria 36099
85 Ga0105239_10009879 3300010375 Bacteria 10720
86 Ga0105239_10422075 3300010375 Bacteria 1511
87 Ga0157373_10000108 3300013100 Bacteria 64836
88 Ga0157373_10003185 3300013100 Bacteria 12406
89 Ga0157373_10161188 3300013100 Bacteria 1578
90 Ga0157371_10000121 3300013102 Bacteria 118793
91 Ga0157371_10001105 3300013102 Bacteria 29209
92 Ga0157371_10005230 3300013102 Bacteria 11028
93 Ga0157371_10078800 3300013102 Bacteria 2334
94 Ga0157370_10001665 3300013104 Bacteria 27358
95 Ga0157370_10154389 3300013104 Bacteria 2136
96 Ga0163162_10003299 3300013306 Bacteria 15442
97 Ga0163162_10023999 3300013306 Bacteria 6018
98 Ga0157372_10000075 3300013307 Bacteria 105528
99 Ga0157375_10069239 3300013308 Bacteria 3534
100 Ga0157380_10613108 3300014326 Bacteria 1079
101 Ga0182008_10000409 3300014497 Bacteria 33166
102 Ga0182008_10003966 3300014497 Bacteria 8762
103 Ga0157379_10007200 3300014968 Bacteria 9622
104 Ga0157376_10135587 3300014969 Bacteria 2202
105 Ga0182007_10000503 3300015262 Bacteria 23206
106 Ga0207427_100152 3300025231 Bacteria 78389
107 Ga0209437_100164 3300025233 Bacteria 145317
108 Ga0209129_1003983 3300025258 Bacteria 6083
109 Ga0209233_1000038 3300025261 Bacteria 548972
110 Ga0209233_1004552 3300025261 Bacteria 4699
111 Ga0207710_10023843 3300025900 Unclassified 2631
112 Ga0207647_10000330 3300025904 Bacteria 38875
113 Ga0207684_10321356 3300025910 Bacteria 1334
114 Ga0207654_10117523 3300025911 Bacteria 1664
115 Ga0207695_10001797 3300025913 Bacteria 33844
116 Ga0207695_10022359 3300025913 Bacteria 7181
117 Ga0207695_10591490 3300025913 Bacteria 991
118 Ga0207671_10000455 3300025914 Bacteria 56340
119 Ga0207671_10013110 3300025914 Bacteria 6621
120 Ga0207659_10003046 3300025926 Bacteria 10005
121 Ga0207687_10007621 3300025927 Bacteria 7118
122 Ga0207690_10009299 3300025932 Bacteria 5839
123 Ga0207686_10009048 3300025934 Bacteria 5392
124 Ga0207686_10012069 3300025934 Bacteria 4745
125 Ga0207711_10023097 3300025941 Bacteria 5208
126 Ga0207711_10070227 3300025941 Bacteria 3037
127 Ga0207661_10057562 3300025944 Bacteria 3126
128 Ga0207667_10135383 3300025949 Bacteria 2537
129 Ga0207667_10789352 3300025949 Bacteria 947
130 Ga0207651_10209976 3300025960 Unclassified 1566
131 Ga0207640_10127696 3300025981 Bacteria 1833
132 Ga0207677_10044319 3300026023 Bacteria 2963
133 Ga0207703_10149242 3300026035 Bacteria 2037
134 Ga0207648_10015193 3300026089 Bacteria 7086
135 Ga0207674_10182998 3300026116 Bacteria 2046
136 Ga0207674_10336549 3300026116 Bacteria 1459
137 Ga0207683_10095625 3300026121 Bacteria 2648
138 Ga0268266_10013943 3300028379 Bacteria 6920
139 Ga0268264_10032572 3300028381 Bacteria 4277
140 Ga0307412_10000017 3300031911 Bacteria 294698
141 Ga0307414_10000581 3300032004 Bacteria 19059
142 Ga0307414_10070352 3300032004 Bacteria 2519
143 Ga0395899_0000002 3300037312 Bacteria 1324310
144 Ga0395905_0029781 3300037471 Bacteria 5144
145 Ga0395901_0099867 3300038443 Bacteria 3044
146 Ga0495650_0000003 3300046471 Bacteria 900730
147 Ga0495584_0001239 3300046491 Bacteria 15575
148 Ga0495585_0000085 3300046492 Bacteria 97836
149 Ga0495585_0000281 3300046492 Bacteria 50967
150 Ga0495606_0000145 3300046507 Bacteria 122857
151 Ga0495610_0006620 3300046512 Bacteria 7917
152 Ga0495616_0000937 3300046513 Bacteria 20994
153 Ga0495616_0026459 3300046513 Bacteria 3088
154 Ga0495648_0002219 3300046524 Bacteria 18188
155 Ga0495648_0036709 3300046524 Bacteria 3157
156 Ga0495648_0049583 3300046524 Bacteria 2572
157 Ga0495609_0011927 3300046538 Bacteria 4129
158 Ga0495609_0153353 3300046538 Bacteria 979
159 Ga0495622_0044463 3300046557 Bacteria 2064
160 Ga0495633_0018764 3300046558 Bacteria 3508
161 Ga0495668_0000127 3300046616 Bacteria 114097
162 Ga0495625_0000005 3300046660 Bacteria 596135
163 Ga0495625_0000175 3300046660 Bacteria 99386
164 Ga0495625_0153116 3300046660 Bacteria 1549
165 Ga0495625_0232474 3300046660 Bacteria 1203
166 Ga0495661_0023008 3300046665 Bacteria 4050
167 Ga0495661_0041861 3300046665 Bacteria 2830
168 Ga0495670_0098412 3300046691 Unclassified 1504
169 Ga0495649_0000003 3300046694 Bacteria 880817
170 Ga0495683_0014884 3300047323 Unclassified 4050
171 Ga0495687_000672 3300047443 Bacteria 38920
172 Ga0495686_0003759 3300047472 Bacteria 12909
173 Ga0496108_0506401 3300048911 Unclassified 1054
174 Ga0496112_0002591 3300048915 Bacteria 14609
175 nmdc:mga0qj67_233950_c1 3300050509 Bacteria 1491
176 nmdc:mga06r32_265530_c1 3300050510 Bacteria 1704
177 nmdc:mga0n895_152083_c1 3300050512 Bacteria 2345
178 nmdc:mga0n895_27_c1 3300050512 Bacteria 89407
179 nmdc:mga0n895_348384_c1 3300050512 Bacteria 1500
180 nmdc:mga0n895_60977_c1 3300050512 Bacteria 3723
181 nmdc:mga0rr50_110256_c1 3300050513 Bacteria 2177
182 nmdc:mga0rr50_118209_c1 3300050513 Unclassified 2106
183 nmdc:mga0rr50_19232_c1 3300050513 Bacteria 4604
184 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
185 nmdc:mga08x19_11196_c1 3300050514 Bacteria 5399
186 nmdc:mga08x19_173_c1 3300050514 Bacteria 53439
187 nmdc:mga08x19_41675_c1 3300050514 Bacteria 2925
188 Ga0500651_0000212 3300053093 Bacteria 36701
189 Ga0500614_030615 3300053123 Bacteria 1314
190 Ga0500618_007051 3300053125 Bacteria 3241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0153353 Ga0495609_0153353_231_881 213
2 3300007076 Ga0075435_100017806 Ga0075435_1000178063 223
3 3300050512 nmdc:mga0n895_152083_c1 nmdc:mga0n895_152083_c1_380_1144 223
4 3300006914 Ga0075436_100029263 Ga0075436_1000292633 229
5 3300050514 nmdc:mga08x19_41675_c1 nmdc:mga08x19_41675_c1_853_1617 229
6 3300006871 Ga0075434_100388846 Ga0075434_1003888462 235
7 3300009147 Ga0114129_10013857 Ga0114129_100138577 235
8 3300048911 Ga0496108_0506401 Ga0496108_0506401_37_756 236
9 iso_pu_bacteria 2928147474 2928147928 245
10 3300046524 Ga0495648_0036709 Ga0495648_0036709_18_767 249
11 3300006914 Ga0075436_100038421 Ga0075436_1000384214 253
12 3300007076 Ga0075435_100325974 Ga0075435_1003259742 253
13 3300050513 nmdc:mga0rr50_19232_c1 nmdc:mga0rr50_19232_c1_1743_2504 253
14 3300050514 nmdc:mga08x19_11196_c1 nmdc:mga08x19_11196_c1_1048_1809 253
15 3300005467 Ga0070706_100313110 Ga0070706_1003131102 254
16 3300025910 Ga0207684_10321356 Ga0207684_103213562 254
17 3300005354 Ga0070675_100005710 Ga0070675_1000057104 255
18 3300005536 Ga0070697_100296327 Ga0070697_1002963272 255
19 3300005842 Ga0068858_100017641 Ga0068858_1000176413 255
20 3300009101 Ga0105247_10023993 Ga0105247_100239933 255
21 3300014326 Ga0157380_10613108 Ga0157380_106131082 255
22 3300014968 Ga0157379_10007200 Ga0157379_100072008 255
23 3300025900 Ga0207710_10023843 Ga0207710_100238433 255
24 3300025926 Ga0207659_10003046 Ga0207659_100030465 255
25 3300028381 Ga0268264_10032572 Ga0268264_100325722 255
26 3300005338 Ga0068868_100283787 Ga0068868_1002837872 256
27 3300006237 Ga0097621_100298926 Ga0097621_1002989261 256
28 3300025913 Ga0207695_10591490 Ga0207695_105914902 256
29 3300025941 Ga0207711_10070227 Ga0207711_100702273 256
30 3300037471 Ga0395905_0029781 Ga0395905_0029781_100_879 256
31 3300048915 Ga0496112_0002591 Ga0496112_0002591_9149_9928 256
32 3300005329 Ga0070683_100337302 Ga0070683_1003373022 258
33 3300005563 Ga0068855_100154775 Ga0068855_1001547753 258
34 3300005614 Ga0068856_100367042 Ga0068856_1003670422 258
35 3300006847 Ga0075431_100032966 Ga0075431_1000329663 258
36 3300006852 Ga0075433_10363941 Ga0075433_103639412 258
37 3300006871 Ga0075434_100082848 Ga0075434_1000828482 258
38 3300006871 Ga0075434_100260126 Ga0075434_1002601262 258
39 3300009174 Ga0105241_10201119 Ga0105241_102011191 258
40 3300013100 Ga0157373_10161188 Ga0157373_101611882 258
41 3300025911 Ga0207654_10117523 Ga0207654_101175231 258
42 3300025949 Ga0207667_10135383 Ga0207667_101353833 258
43 3300050509 nmdc:mga0qj67_233950_c1 nmdc:mga0qj67_233950_c1_300_1079 258
44 3300050510 nmdc:mga06r32_265530_c1 nmdc:mga06r32_265530_c1_781_1560 258
45 3300050512 nmdc:mga0n895_348384_c1 nmdc:mga0n895_348384_c1_688_1464 258
46 3300005329 Ga0070683_100013913 Ga0070683_1000139136 259
47 3300005338 Ga0068868_100556880 Ga0068868_1005568801 259
48 3300005445 Ga0070708_100170407 Ga0070708_1001704072 259
49 3300005535 Ga0070684_100102166 Ga0070684_1001021663 259
50 3300005843 Ga0068860_100190340 Ga0068860_1001903402 259
51 3300005844 Ga0068862_100273371 Ga0068862_1002733712 259
52 3300006237 Ga0097621_100523633 Ga0097621_1005236332 259
53 3300009553 Ga0105249_10450009 Ga0105249_104500092 259
54 3300025944 Ga0207661_10057562 Ga0207661_100575622 259
55 3300046491 Ga0495584_0001239 Ga0495584_0001239_6096_6884 259
56 3300046524 Ga0495648_0002219 Ga0495648_0002219_16526_17314 259
57 3300046691 Ga0495670_0098412 Ga0495670_0098412_151_939 259
58 3300047323 Ga0495683_0014884 Ga0495683_0014884_1587_2375 259
59 3300047472 Ga0495686_0003759 Ga0495686_0003759_1977_2765 259
60 3300005330 Ga0070690_100116306 Ga0070690_1001163062 260
61 3300005338 Ga0068868_100071007 Ga0068868_1000710072 260
62 3300005364 Ga0070673_100499870 Ga0070673_1004998702 260
63 3300005456 Ga0070678_100054490 Ga0070678_1000544902 260
64 3300005459 Ga0068867_100104923 Ga0068867_1001049232 260
65 3300005544 Ga0070686_100160029 Ga0070686_1001600292 260
66 3300005548 Ga0070665_100004133 Ga0070665_1000041337 260
67 3300005842 Ga0068858_100181074 Ga0068858_1001810742 260
68 3300005843 Ga0068860_100382791 Ga0068860_1003827912 260
69 3300006237 Ga0097621_100017911 Ga0097621_1000179114 260
70 3300006358 Ga0068871_100001784 Ga0068871_1000017842 260
71 3300006881 Ga0068865_100021965 Ga0068865_1000219655 260
72 3300006881 Ga0068865_100025291 Ga0068865_1000252914 260
73 3300009098 Ga0105245_10012881 Ga0105245_100128814 260
74 3300009176 Ga0105242_10043592 Ga0105242_100435924 260
75 3300009177 Ga0105248_10038806 Ga0105248_100388062 260
76 3300009177 Ga0105248_10157925 Ga0105248_101579252 260
77 3300013306 Ga0163162_10023999 Ga0163162_100239994 260
78 3300013308 Ga0157375_10069239 Ga0157375_100692392 260
79 3300014969 Ga0157376_10135587 Ga0157376_101355873 260
80 3300025927 Ga0207687_10007621 Ga0207687_100076212 260
81 3300025934 Ga0207686_10009048 Ga0207686_100090485 260
82 3300025934 Ga0207686_10012069 Ga0207686_100120696 260
83 3300025941 Ga0207711_10023097 Ga0207711_100230972 260
84 3300025960 Ga0207651_10209976 Ga0207651_102099762 260
85 3300026023 Ga0207677_10044319 Ga0207677_100443194 260
86 3300026035 Ga0207703_10149242 Ga0207703_101492422 260
87 3300026089 Ga0207648_10015193 Ga0207648_100151936 260
88 3300026121 Ga0207683_10095625 Ga0207683_100956253 260
89 3300028379 Ga0268266_10013943 Ga0268266_100139432 260
90 3300006852 Ga0075433_10255776 Ga0075433_102557762 262
91 3300007076 Ga0075435_100008705 Ga0075435_1000087054 262
92 3300050513 nmdc:mga0rr50_110256_c1 nmdc:mga0rr50_110256_c1_766_1554 262
93 3300005262 Ga0065165_1006147 Ga0065165_10061473 263
94 3300005563 Ga0068855_100240081 Ga0068855_1002400812 263
95 3300006028 Ga0070717_10053014 Ga0070717_100530144 263
96 3300009093 Ga0105240_10039382 Ga0105240_100393824 263
97 3300009551 Ga0105238_10025060 Ga0105238_100250602 263
98 3300025913 Ga0207695_10001797 Ga0207695_100017972 263
99 3300025949 Ga0207667_10789352 Ga0207667_107893521 263
100 iso_pu_bacteria 2599185184 2599477676 263
101 iso_pu_bacteria 2738541284 2738763843 263
102 iso_pu_bacteria 2775506987 2776613679 263
103 iso_pu_bacteria 2919437846 2919439849 263
104 iso_pu_bacteria 2928078545 2928079589 263
105 iso_pu_bacteria 2932082852 2932086778 263
106 3300005549 Ga0070704_100192537 Ga0070704_1001925372 264
107 3300005468 Ga0070707_100063282 Ga0070707_1000632824 265
108 3300006871 Ga0075434_100000001 Ga0075434_10000000165 265
109 3300006914 Ga0075436_100000127 Ga0075436_10000012739 265
110 3300007076 Ga0075435_100000007 Ga0075435_10000000765 265
111 3300050512 nmdc:mga0n895_27_c1 nmdc:mga0n895_27_c1_79931_80728 265
112 3300050513 nmdc:mga0rr50_6_c1 nmdc:mga0rr50_6_c1_138492_139289 265
113 3300050514 nmdc:mga08x19_173_c1 nmdc:mga08x19_173_c1_50546_51343 265
114 2162886007 SwRhRL2b_contig_2449184 SwRhRL2b_0654.00002350 267
115 2162886007 SwRhRL2b_contig_41667 SwRhRL2b_0538.00005050 267
116 3300001904 JGI24736J21556_1000330 JGI24736J21556_10003306 267
117 3300001989 JGI24739J22299_10001285 JGI24739J22299_100012856 267
118 3300001989 JGI24739J22299_10001294 JGI24739J22299_100012947 267
119 3300001990 JGI24737J22298_10000149 JGI24737J22298_100001498 267
120 3300001990 JGI24737J22298_10009072 JGI24737J22298_100090723 267
121 3300001990 JGI24737J22298_10009428 JGI24737J22298_100094284 267
122 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001431 267
123 3300002067 JGI24735J21928_10003511 JGI24735J21928_100035112 267
124 3300002772 JGI25164J39214_1000894 JGI25164J39214_10008942 267
125 3300003214 JGI25165J46597_1002140 JGI25165J46597_10021404 267
126 3300003322 rootL2_10081237 rootL2_100812372 267
127 3300005288 Ga0065714_10002986 Ga0065714_100029864 267
128 3300005288 Ga0065714_10009071 Ga0065714_100090711 267
129 3300005288 Ga0065714_10087275 Ga0065714_100872752 267
130 3300005289 Ga0065704_10000223 Ga0065704_1000022356 267
131 3300005366 Ga0070659_100014622 Ga0070659_1000146222 267
132 3300005518 Ga0070699_100012294 Ga0070699_1000122946 267
133 3300005536 Ga0070697_100122426 Ga0070697_1001224262 267
134 3300005577 Ga0068857_100281331 Ga0068857_1002813312 267
135 3300006844 Ga0075428_100395933 Ga0075428_1003959332 267
136 3300009093 Ga0105240_10369633 Ga0105240_103696332 267
137 3300009545 Ga0105237_10007963 Ga0105237_100079635 267
138 3300009545 Ga0105237_10020332 Ga0105237_100203325 267
139 3300010375 Ga0105239_10001169 Ga0105239_1000116913 267
140 3300010375 Ga0105239_10009879 Ga0105239_100098796 267
141 3300010375 Ga0105239_10422075 Ga0105239_104220752 267
142 3300013100 Ga0157373_10000108 Ga0157373_1000010838 267
143 3300013100 Ga0157373_10003185 Ga0157373_1000318510 267
144 3300013102 Ga0157371_10000121 Ga0157371_1000012159 267
145 3300013102 Ga0157371_10001105 Ga0157371_1000110521 267
146 3300013102 Ga0157371_10005230 Ga0157371_100052304 267
147 3300013102 Ga0157371_10078800 Ga0157371_100788002 267
148 3300013104 Ga0157370_10001665 Ga0157370_100016657 267
149 3300013104 Ga0157370_10154389 Ga0157370_101543892 267
150 3300013306 Ga0163162_10003299 Ga0163162_1000329924 267
151 3300013307 Ga0157372_10000075 Ga0157372_1000007546 267
152 3300014497 Ga0182008_10000409 Ga0182008_1000040913 267
153 3300014497 Ga0182008_10003966 Ga0182008_100039663 267
154 3300015262 Ga0182007_10000503 Ga0182007_1000050319 267
155 3300025231 Ga0207427_100152 Ga0207427_10015228 267
156 3300025233 Ga0209437_100164 Ga0209437_10016486 267
157 3300025258 Ga0209129_1003983 Ga0209129_10039834 267
158 3300025261 Ga0209233_1000038 Ga0209233_1000038516 267
159 3300025261 Ga0209233_1004552 Ga0209233_10045522 267
160 3300025904 Ga0207647_10000330 Ga0207647_1000033022 267
161 3300025913 Ga0207695_10022359 Ga0207695_100223592 267
162 3300025914 Ga0207671_10000455 Ga0207671_1000045545 267
163 3300025914 Ga0207671_10013110 Ga0207671_100131105 267
164 3300025932 Ga0207690_10009299 Ga0207690_100092994 267
165 3300025981 Ga0207640_10127696 Ga0207640_101276962 267
166 3300026116 Ga0207674_10182998 Ga0207674_101829982 267
167 3300026116 Ga0207674_10336549 Ga0207674_103365492 267
168 3300031911 Ga0307412_10000017 Ga0307412_1000001724 267
169 3300032004 Ga0307414_10000581 Ga0307414_100005813 267
170 3300032004 Ga0307414_10070352 Ga0307414_100703522 267
171 3300037312 Ga0395899_0000002 Ga0395899_0000002_957713_958516 267
172 3300038443 Ga0395901_0099867 Ga0395901_0099867_395_1204 267
173 3300046471 Ga0495650_0000003 Ga0495650_0000003_148738_149541 267
174 3300046492 Ga0495585_0000085 Ga0495585_0000085_51218_52021 267
175 3300046492 Ga0495585_0000281 Ga0495585_0000281_24538_25341 267
176 3300046507 Ga0495606_0000145 Ga0495606_0000145_96924_97727 267
177 3300046512 Ga0495610_0006620 Ga0495610_0006620_5234_6037 267
178 3300046513 Ga0495616_0000937 Ga0495616_0000937_1992_2795 267
179 3300046513 Ga0495616_0026459 Ga0495616_0026459_1854_2657 267
180 3300046524 Ga0495648_0049583 Ga0495648_0049583_556_1359 267
181 3300046538 Ga0495609_0011927 Ga0495609_0011927_3075_3878 267
182 3300046557 Ga0495622_0044463 Ga0495622_0044463_49_852 267
183 3300046558 Ga0495633_0018764 Ga0495633_0018764_144_947 267
184 3300046616 Ga0495668_0000127 Ga0495668_0000127_37728_38531 267
185 3300046660 Ga0495625_0000005 Ga0495625_0000005_265761_266564 267
186 3300046660 Ga0495625_0000175 Ga0495625_0000175_57324_58127 267
187 3300046660 Ga0495625_0153116 Ga0495625_0153116_456_1259 267
188 3300046660 Ga0495625_0232474 Ga0495625_0232474_209_1012 267
189 3300046665 Ga0495661_0023008 Ga0495661_0023008_1127_1930 267
190 3300046665 Ga0495661_0041861 Ga0495661_0041861_149_952 267
191 3300046694 Ga0495649_0000003 Ga0495649_0000003_265768_266571 267
192 3300047443 Ga0495687_000672 Ga0495687_000672_29010_29813 267
193 3300050512 nmdc:mga0n895_60977_c1 nmdc:mga0n895_60977_c1_2339_3145 267
194 3300050513 nmdc:mga0rr50_118209_c1 nmdc:mga0rr50_118209_c1_857_1672 267
195 3300053093 Ga0500651_0000212 Ga0500651_0000212_68_871 267
196 3300053123 Ga0500614_030615 Ga0500614_030615_71_874 267
197 3300053125 Ga0500618_007051 Ga0500618_007051_904_1707 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

26

211

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eyt-assembly2.cif.gz_A fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf with andilesin c and nog 0.8398 4 242
6oxj-assembly1.cif.gz_A x-ray crystal structure of y140f ftmox1 bound to fe(ii) 0.8323 3 242
5ybs-assembly1.cif.gz_A fe(ii)/(alpha)ketoglutarate-dependent dioxygenase prha-v150l/a232s in complex with berkeleyone a 0.8319 3 242
4nao-assembly1.cif.gz_A-2 crystal structure of eash 0.8262 4 240
7de0-assembly1.cif.gz_B crystal structure of ftmox1 y224f mutation 0.8223 3 242
ID Description Score Start End Superfamily
af_P9WI91_4_259_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9194 9 253 2.60.120.620
af_P9WI91_4_259_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8786 9 253 2.60.120.620
af_A0A1D6Q4J3_1_128_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8276 117 211 2.60.120.620
4naoA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8262 4 240 2.60.120.620
af_A8E5P7_122_256_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8108 117 210 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A519NVQ3-F1-model_v4 deleted 0.9835 1 267
AF-A0A1H8ADR3-F1-model_v4 Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family 0.9813 1 267 GO:0051213
AF-A0A519KUC2-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9765 1 175 GO:0051213
AF-A0A1H8GRG3-F1-model_v4 Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family 0.9723 1 267 GO:0051213
AF-A0A519KUC2-F1-model_v4 Phytanoyl-CoA dioxygenase 0.971 1 175 GO:0051213

Feature Viewer

pLDDT pTM Quality
92.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map