F302405

General Info

Members Datasets Scaffolds Average Seq Length
197 139 178 123

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10010380|rootH2_100103803
Length 138
Sequence MGQQNLQKNHESNETAGSVRVDSWIWSVRLTRSRSMAATACKAGHVKVNGERVKPAQTVKVGDEVRLFHAGRERVVVVSRLLAKRVGAPVAAEAYVDNSADALAIGVRDRGAGRPTKRDRRELERLHGRRGSQGHAQG

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
4 2643221649 Leifsonia sp. Root4 Isolate Unclassified
5 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
6 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
7 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
8 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
9 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
10 2867475112 Streptomyces sp. TM32 Isolate Unclassified
11 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
12 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
13 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
14 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
15 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
16 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
41 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
42 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
43 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
44 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
64 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
67 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
81 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
114 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
115 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
116 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
117 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
118 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
121 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
122 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
126 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
129 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
132 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
133 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
134 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
135 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
138 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
139 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.34
Metatranscriptomes 1.02
Isolates 9.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 13.71
Nodule 0
Rhizoplane 3.05
Rhizosphere 71.07
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10010380 3300003320 Bacteria 5751
2 Ga0070658_10000135 3300005327 Bacteria 64641
3 Ga0070711_100215335 3300005439 Bacteria 1490
4 Ga0070663_100282913 3300005455 Bacteria 1322
5 Ga0070685_10272867 3300005466 Bacteria 1129
6 Ga0068855_100038169 3300005563 Bacteria 5707
7 Ga0157370_10048542 3300013104 Bacteria 4066
8 Ga0157369_10409184 3300013105 Bacteria 1407
9 Ga0206354_11530465 3300020081 Bacteria 1031
10 Ga0206353_10039005 3300020082 Bacteria 1864
11 Ga0209759_1030827 3300025256 Bacteria 1053
12 Ga0207426_1000643 3300025302 Bacteria 43590
13 Ga0207705_10000001 3300025909 Bacteria 2061880
14 Ga0207663_10313757 3300025916 Bacteria 1176
15 Ga0207667_10044388 3300025949 Bacteria 4710
16 Ga0307517_10022250 3300028786 Bacteria 7952
17 Ga0307511_10078426 3300030521 Bacteria 2343
18 Ga0307509_10672850 3300031507 Bacteria 702
19 Ga0307508_10024402 3300031616 Bacteria 5487
20 Ga0307410_10012874 3300031852 Bacteria 4857
21 Ga0307406_10000442 3300031901 Bacteria 24168
22 Ga0307416_100047653 3300032002 Bacteria 3394
23 Ga0307415_100043859 3300032126 Bacteria 2987
24 Ga0439465_0095859 3300041413 Bacteria 1020
25 Ga0451787_527891 3300041441 Bacteria 566
26 Ga0451789_0634575 3300041443 Bacteria 1720
27 Ga0451797_0204266 3300041453 Bacteria 527
28 Ga0451797_0215038 3300041453 Unclassified 723
29 Ga0451797_0335730 3300041453 Bacteria 1109
30 Ga0466969_0039751 3300044656 Bacteria 2360
31 Ga0466972_0173574 3300044658 Bacteria 1011
32 Ga0466961_0093396 3300044693 Bacteria 1898
33 Ga0466971_0385260 3300044719 Bacteria 682
34 Ga0466970_0003011 3300044765 Bacteria 8174
35 Ga0466970_0071898 3300044765 Bacteria 1861
36 Ga0466970_0135817 3300044765 Bacteria 1353
37 Ga0466959_0112238 3300045049 Bacteria 1944
38 Ga0466967_0672572 3300045976 Bacteria 1025
39 Ga0495627_000214 3300046453 Bacteria 62803
40 Ga0495592_0066241 3300046454 Bacteria 2643
41 Ga0495629_0053739 3300046459 Bacteria 2817
42 Ga0495638_0058100 3300046460 Bacteria 2398
43 Ga0495651_0160359 3300046462 Bacteria 1612
44 Ga0495662_0465247 3300046476 Bacteria 620
45 Ga0495585_0070344 3300046492 Bacteria 1909
46 Ga0495585_0101830 3300046492 Bacteria 1535
47 Ga0495594_0357568 3300046499 Bacteria 831
48 Ga0495607_0214506 3300046501 Bacteria 945
49 Ga0495628_0063122 3300046516 Bacteria 2903
50 Ga0495643_0002879 3300046522 Bacteria 13057
51 Ga0495666_0384706 3300046526 Bacteria 631
52 Ga0495652_0132378 3300046529 Bacteria 1972
53 Ga0495640_0003397 3300046533 Bacteria 12815
54 Ga0495634_0596193 3300046642 Bacteria 641
55 Ga0495635_0779955 3300046663 Bacteria 617
56 Ga0495588_0296754 3300046674 Bacteria 851
57 Ga0495657_0065793 3300046675 Bacteria 2383
58 Ga0495599_0690888 3300046678 Bacteria 589
59 Ga0495658_0074684 3300046683 Bacteria 1976
60 Ga0495613_0091445 3300046689 Bacteria 2203
61 Ga0495670_0015279 3300046691 Bacteria 3774
62 Ga0495600_0108801 3300046809 Bacteria 1805
63 Ga0495660_0010076 3300046810 Bacteria 5497
64 Ga0495581_0622997 3300047315 Bacteria 624
65 Ga0495604_0038655 3300047317 Bacteria 3753
66 Ga0495604_0055573 3300047317 Bacteria 3051
67 Ga0495672_0007541 3300047320 Bacteria 8166
68 Ga0495672_0429451 3300047320 Bacteria 599
69 Ga0495683_0016625 3300047323 Bacteria 3819
70 Ga0495687_025120 3300047443 Bacteria 2822
71 Ga0495687_081346 3300047443 Bacteria 1267
72 Ga0495685_000842 3300047447 Bacteria 9351
73 Ga0495685_234096 3300047447 Bacteria 584
74 Ga0495681_0000194 3300047470 Bacteria 51439
75 Ga0495686_0028786 3300047472 Bacteria 3617
76 Ga0495686_0168216 3300047472 Bacteria 1276
77 Ga0495686_0592185 3300047472 Bacteria 575
78 Ga0495593_0573238 3300047673 Bacteria 566
79 Ga0495615_0060125 3300048090 Bacteria 1001
80 Ga0496114_0823931 3300048917 Bacteria 807
81 Ga0496119_0056187 3300048922 Bacteria 2386
82 Ga0496119_0091263 3300048922 Bacteria 1730
83 Ga0496120_0084771 3300048923 Bacteria 1707
84 Ga0496122_0004457 3300048925 Bacteria 17360
85 Ga0496122_0311045 3300048925 Bacteria 843
86 Ga0496123_0007182 3300048926 Bacteria 10569
87 Ga0496123_0184446 3300048926 Bacteria 1086
88 Ga0496125_0000097 3300048928 Bacteria 204607
89 Ga0496125_0329765 3300048928 Bacteria 921
90 Ga0501031_0229365 3300049568 Bacteria 1208
91 Ga0501031_0491919 3300049568 Bacteria 791
92 Ga0501032_0004563 3300049569 Bacteria 10421
93 Ga0501032_0056868 3300049569 Bacteria 2628
94 Ga0501032_0122269 3300049569 Bacteria 1720
95 Ga0501033_0090194 3300049570 Bacteria 2242
96 Ga0501033_0123980 3300049570 Bacteria 1873
97 Ga0501033_0343886 3300049570 Bacteria 1045
98 Ga0501034_0096154 3300049571 Bacteria 2958
99 Ga0501034_0110936 3300049571 Bacteria 2734
100 Ga0501034_0199183 3300049571 Bacteria 1961
101 Ga0501034_0251358 3300049571 Bacteria 1712
102 Ga0501034_0289726 3300049571 Bacteria 1575
103 Ga0501034_0355381 3300049571 Bacteria 1393
104 Ga0501036_0013127 3300049572 Bacteria 6881
105 Ga0501036_0035675 3300049572 Bacteria 4207
106 Ga0501036_0184768 3300049572 Bacteria 1754
107 Ga0501037_0071896 3300049573 Bacteria 2516
108 Ga0501037_0089036 3300049573 Bacteria 2234
109 Ga0501037_0118853 3300049573 Bacteria 1901
110 Ga0501037_0694465 3300049573 Bacteria 677
111 Ga0501038_0025952 3300049574 Bacteria 5218
112 Ga0501038_0045941 3300049574 Bacteria 3788
113 Ga0501038_0062483 3300049574 Bacteria 3182
114 Ga0501038_0112147 3300049574 Bacteria 2258
115 Ga0501039_0034786 3300049575 Bacteria 3887
116 Ga0501039_0326724 3300049575 Bacteria 1206
117 Ga0501039_0465097 3300049575 Bacteria 993
118 Ga0501042_0187025 3300049578 Bacteria 1494
119 Ga0501043_0004703 3300049579 Bacteria 11066
120 Ga0501043_0019087 3300049579 Bacteria 5382
121 Ga0501043_0036165 3300049579 Bacteria 3884
122 Ga0501043_0045576 3300049579 Bacteria 3449
123 Ga0501043_0082733 3300049579 Bacteria 2523
124 Ga0501046_0430284 3300049580 Bacteria 951
125 Ga0501047_0000261 3300049581 Bacteria 61793
126 Ga0501047_0002745 3300049581 Bacteria 16764
127 Ga0501047_0009998 3300049581 Bacteria 8968
128 Ga0501047_0100406 3300049581 Bacteria 2773
129 Ga0501047_0351034 3300049581 Bacteria 1312
130 Ga0501069_0023002 3300049585 Bacteria 3394
131 Ga0501070_0001046 3300049586 Bacteria 24928
132 Ga0501070_0001884 3300049586 Bacteria 18542
133 Ga0501071_0000865 3300049587 Bacteria 16307
134 Ga0501073_0615985 3300049589 Bacteria 749
135 Ga0501074_0070494 3300049590 Bacteria 2513
136 Ga0501080_0263755 3300049742 Bacteria 1569
137 Ga0501083_0395748 3300049744 Bacteria 899
138 Ga0501083_0527058 3300049744 Bacteria 769
139 Ga0501035_0003911 3300049822 Bacteria 14200
140 Ga0501035_0037334 3300049822 Bacteria 4399
141 Ga0501035_0057567 3300049822 Bacteria 3465
142 Ga0501035_0086415 3300049822 Bacteria 2763
143 Ga0501044_0010212 3300049823 Bacteria 10201
144 Ga0501044_0018101 3300049823 Bacteria 7554
145 Ga0501044_0029948 3300049823 Bacteria 5738
146 Ga0501044_0061781 3300049823 Bacteria 3831
147 Ga0501044_0113972 3300049823 Bacteria 2710
148 Ga0501044_0135134 3300049823 Bacteria 2457
149 Ga0501044_0238138 3300049823 Bacteria 1765
150 Ga0501045_0338332 3300049824 Bacteria 1120
151 Ga0500578_0073654 3300053086 Bacteria 2175
152 Ga0500643_000334 3300053087 Bacteria 37718
153 Ga0500566_0048949 3300053094 Bacteria 2422
154 Ga0500566_0375369 3300053094 Bacteria 644
155 Ga0500641_0165368 3300053096 Bacteria 953
156 Ga0500654_041378 3300053099 Bacteria 2612
157 Ga0500660_241593 3300053100 Bacteria 567
158 Ga0500556_0000001 3300053104 Bacteria 1135060
159 Ga0500560_000674 3300053107 Bacteria 5061
160 Ga0500560_083320 3300053107 Bacteria 1064
161 Ga0500569_034175 3300053109 Bacteria 1449
162 Ga0500580_079650 3300053113 Bacteria 1331
163 Ga0500652_001549 3300053131 Bacteria 7033
164 Ga0500658_0015225 3300053134 Bacteria 2853
165 Ga0500559_0000192 3300053136 Bacteria 49223
166 Ga0500561_0001819 3300053137 Bacteria 3511
167 Ga0500568_0000016 3300053139 Bacteria 217194
168 Ga0500568_0145781 3300053139 Bacteria 877
169 Ga0500573_0186998 3300053140 Bacteria 1109
170 Ga0500600_0007047 3300053149 Bacteria 6742
171 Ga0500616_0086544 3300053153 Bacteria 1562
172 Ga0500627_0215949 3300053158 Bacteria 857
173 Ga0500633_0013228 3300053160 Bacteria 2305
174 Ga0500634_0040383 3300053161 Bacteria 2535
175 Ga0500656_023713 3300053732 Bacteria 777
176 Ga0500587_011255 3300053739 Bacteria 1131
177 Ga0501082_0090459 3300060353 Bacteria 2642
178 Ga0501082_0114989 3300060353 Bacteria 2330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0527058 Ga0501083_0527058_15_383 99
2 3300020081 Ga0206354_11530465 Ga0206354_115304652 106
3 3300020082 Ga0206353_10039005 Ga0206353_100390053 106
4 3300005439 Ga0070711_100215335 Ga0070711_1002153352 110
5 3300025916 Ga0207663_10313757 Ga0207663_103137572 110
6 3300048925 Ga0496122_0311045 Ga0496122_0311045_16_378 110
7 3300048928 Ga0496125_0000097 Ga0496125_0000097_3648_4010 110
8 3300005327 Ga0070658_10000135 Ga0070658_1000013552 111
9 3300005455 Ga0070663_100282913 Ga0070663_1002829132 111
10 3300005563 Ga0068855_100038169 Ga0068855_1000381696 111
11 3300013104 Ga0157370_10048542 Ga0157370_100485424 111
12 3300025909 Ga0207705_10000001 Ga0207705_100000011889 111
13 3300025949 Ga0207667_10044388 Ga0207667_100443885 111
14 3300048923 Ga0496120_0084771 Ga0496120_0084771_48_401 111
15 iso_pu_bacteria 2643221587 2643947145 111
16 iso_pu_bacteria 2643221677 2644433384 111
17 3300053107 Ga0500560_083320 Ga0500560_083320_163_555 112
18 3300049571 Ga0501034_0251358 Ga0501034_0251358_507_869 113
19 3300049744 Ga0501083_0395748 Ga0501083_0395748_209_571 113
20 3300060353 Ga0501082_0090459 Ga0501082_0090459_1006_1368 113
21 iso_pu_bacteria 2852643534 2852645299 113
22 iso_pu_bacteria 8056667051 8056668766 113
23 3300046674 Ga0495588_0296754 Ga0495588_0296754_308_700 114
24 3300046683 Ga0495658_0074684 Ga0495658_0074684_454_846 114
25 3300048925 Ga0496122_0004457 Ga0496122_0004457_12053_12415 114
26 3300048926 Ga0496123_0007182 Ga0496123_0007182_6994_7356 114
27 3300053094 Ga0500566_0375369 Ga0500566_0375369_126_518 114
28 3300053113 Ga0500580_079650 Ga0500580_079650_595_987 114
29 iso_pu_bacteria 2857720070 2857720462 114
30 iso_pu_bacteria 2867475112 2867479255 114
31 iso_pu_bacteria 3006425503 3006430852 114
32 3300028786 Ga0307517_10022250 Ga0307517_100222505 115
33 3300030521 Ga0307511_10078426 Ga0307511_100784262 115
34 3300031507 Ga0307509_10672850 Ga0307509_106728502 115
35 3300031616 Ga0307508_10024402 Ga0307508_100244024 115
36 3300046460 Ga0495638_0058100 Ga0495638_0058100_1537_1929 115
37 3300046492 Ga0495585_0070344 Ga0495585_0070344_1231_1623 115
38 3300046499 Ga0495594_0357568 Ga0495594_0357568_293_685 115
39 3300046501 Ga0495607_0214506 Ga0495607_0214506_387_779 115
40 3300046522 Ga0495643_0002879 Ga0495643_0002879_2452_2844 115
41 3300046691 Ga0495670_0015279 Ga0495670_0015279_401_793 115
42 3300046810 Ga0495660_0010076 Ga0495660_0010076_2796_3188 115
43 3300047323 Ga0495683_0016625 Ga0495683_0016625_264_656 115
44 3300047443 Ga0495687_081346 Ga0495687_081346_489_881 115
45 3300047447 Ga0495685_000842 Ga0495685_000842_7301_7693 115
46 3300047470 Ga0495681_0000194 Ga0495681_0000194_7826_8218 115
47 3300047472 Ga0495686_0168216 Ga0495686_0168216_457_849 115
48 3300047673 Ga0495593_0573238 Ga0495593_0573238_11_403 115
49 3300048090 Ga0495615_0060125 Ga0495615_0060125_387_779 115
50 3300048926 Ga0496123_0184446 Ga0496123_0184446_291_656 115
51 3300049571 Ga0501034_0289726 Ga0501034_0289726_271_636 115
52 3300049579 Ga0501043_0045576 Ga0501043_0045576_2064_2429 115
53 3300049585 Ga0501069_0023002 Ga0501069_0023002_2171_2536 115
54 3300049586 Ga0501070_0001046 Ga0501070_0001046_17231_17596 115
55 3300049587 Ga0501071_0000865 Ga0501071_0000865_5500_5865 115
56 3300049589 Ga0501073_0615985 Ga0501073_0615985_237_602 115
57 3300049590 Ga0501074_0070494 Ga0501074_0070494_1440_1805 115
58 3300053086 Ga0500578_0073654 Ga0500578_0073654_825_1217 115
59 3300053094 Ga0500566_0048949 Ga0500566_0048949_884_1276 115
60 3300053096 Ga0500641_0165368 Ga0500641_0165368_479_871 115
61 3300053099 Ga0500654_041378 Ga0500654_041378_531_923 115
62 3300053100 Ga0500660_241593 Ga0500660_241593_10_402 115
63 3300053107 Ga0500560_000674 Ga0500560_000674_71_463 115
64 3300053109 Ga0500569_034175 Ga0500569_034175_612_1004 115
65 3300053131 Ga0500652_001549 Ga0500652_001549_5152_5544 115
66 3300053134 Ga0500658_0015225 Ga0500658_0015225_1695_2087 115
67 3300053137 Ga0500561_0001819 Ga0500561_0001819_977_1369 115
68 3300053140 Ga0500573_0186998 Ga0500573_0186998_643_1035 115
69 3300053149 Ga0500600_0007047 Ga0500600_0007047_1132_1524 115
70 3300053153 Ga0500616_0086544 Ga0500616_0086544_385_777 115
71 3300053158 Ga0500627_0215949 Ga0500627_0215949_10_402 115
72 3300053160 Ga0500633_0013228 Ga0500633_0013228_746_1138 115
73 3300053161 Ga0500634_0040383 Ga0500634_0040383_1550_1942 115
74 3300053732 Ga0500656_023713 Ga0500656_023713_42_434 115
75 3300053739 Ga0500587_011255 Ga0500587_011255_438_830 115
76 3300060353 Ga0501082_0114989 Ga0501082_0114989_740_1105 115
77 iso_pu_bacteria 2585428094 2587862492 115
78 iso_pu_bacteria 2643221649 2644279230 115
79 iso_pu_bacteria 2808606368 2808885311 115
80 iso_pu_bacteria 2857733635 2857735464 115
81 iso_pu_bacteria 2928090899 2928092447 115
82 iso_pu_bacteria 2984580707 2984580779 115
83 3300031901 Ga0307406_10000442 Ga0307406_1000044221 116
84 3300041453 Ga0451797_0204266 Ga0451797_0204266_11_379 116
85 iso_pu_bacteria 2966924647 2966927289 116
86 3300041443 Ga0451789_0634575 Ga0451789_0634575_927_1298 117
87 3300041453 Ga0451797_0335730 Ga0451797_0335730_374_745 117
88 3300047320 Ga0495672_0007541 Ga0495672_0007541_2058_2429 117
89 iso_pu_bacteria 2585428157 2588108114 117
90 iso_pu_bacteria 2946080515 2946080536 117
91 iso_pu_bacteria 2997451912 2997452169 117
92 iso_pu_bacteria 8056447290 8056452026 117
93 3300025302 Ga0207426_1000643 Ga0207426_100064328 118
94 3300031852 Ga0307410_10012874 Ga0307410_100128742 118
95 3300032002 Ga0307416_100047653 Ga0307416_1000476534 118
96 3300032126 Ga0307415_100043859 Ga0307415_1000438593 118
97 3300041453 Ga0451797_0215038 Ga0451797_0215038_273_650 119
98 3300044656 Ga0466969_0039751 Ga0466969_0039751_771_1151 119
99 3300044693 Ga0466961_0093396 Ga0466961_0093396_1064_1444 119
100 3300044719 Ga0466971_0385260 Ga0466971_0385260_160_540 119
101 3300044765 Ga0466970_0135817 Ga0466970_0135817_106_486 119
102 3300045049 Ga0466959_0112238 Ga0466959_0112238_356_736 119
103 3300047320 Ga0495672_0429451 Ga0495672_0429451_202_579 119
104 3300047472 Ga0495686_0028786 Ga0495686_0028786_1878_2255 119
105 3300047472 Ga0495686_0592185 Ga0495686_0592185_109_486 119
106 3300049574 Ga0501038_0062483 Ga0501038_0062483_1986_2354 119
107 3300053104 Ga0500556_0000001 Ga0500556_0000001_72492_72869 119
108 3300053139 Ga0500568_0000016 Ga0500568_0000016_139962_140339 119
109 3300046453 Ga0495627_000214 Ga0495627_000214_49252_49623 120
110 3300048917 Ga0496114_0823931 Ga0496114_0823931_19_390 120
111 3300048922 Ga0496119_0056187 Ga0496119_0056187_1819_2199 120
112 3300048928 Ga0496125_0329765 Ga0496125_0329765_310_690 120
113 3300053087 Ga0500643_000334 Ga0500643_000334_18157_18531 120
114 3300047443 Ga0495687_025120 Ga0495687_025120_1021_1476 121
115 3300053136 Ga0500559_0000192 Ga0500559_0000192_31019_31420 121
116 3300025256 Ga0209759_1030827 Ga0209759_10308271 122
117 3300041441 Ga0451787_527891 Ga0451787_527891_11_400 123
118 3300044658 Ga0466972_0173574 Ga0466972_0173574_89_469 123
119 3300044765 Ga0466970_0003011 Ga0466970_0003011_1416_1796 123
120 3300044765 Ga0466970_0071898 Ga0466970_0071898_1330_1710 123
121 3300045976 Ga0466967_0672572 Ga0466967_0672572_181_561 123
122 3300046454 Ga0495592_0066241 Ga0495592_0066241_757_1152 123
123 3300046459 Ga0495629_0053739 Ga0495629_0053739_2390_2785 123
124 3300046462 Ga0495651_0160359 Ga0495651_0160359_436_831 123
125 3300046476 Ga0495662_0465247 Ga0495662_0465247_37_432 123
126 3300046516 Ga0495628_0063122 Ga0495628_0063122_1596_1991 123
127 3300046526 Ga0495666_0384706 Ga0495666_0384706_172_567 123
128 3300046529 Ga0495652_0132378 Ga0495652_0132378_1218_1613 123
129 3300046533 Ga0495640_0003397 Ga0495640_0003397_572_967 123
130 3300046642 Ga0495634_0596193 Ga0495634_0596193_89_484 123
131 3300046663 Ga0495635_0779955 Ga0495635_0779955_177_572 123
132 3300046675 Ga0495657_0065793 Ga0495657_0065793_1409_1804 123
133 3300046678 Ga0495599_0690888 Ga0495599_0690888_18_413 123
134 3300046689 Ga0495613_0091445 Ga0495613_0091445_695_1090 123
135 3300046809 Ga0495600_0108801 Ga0495600_0108801_725_1120 123
136 3300047315 Ga0495581_0622997 Ga0495581_0622997_82_477 123
137 3300047317 Ga0495604_0038655 Ga0495604_0038655_2270_2665 123
138 3300049573 Ga0501037_0071896 Ga0501037_0071896_1652_2050 124
139 3300049578 Ga0501042_0187025 Ga0501042_0187025_951_1349 124
140 3300049581 Ga0501047_0000261 Ga0501047_0000261_15358_15756 124
141 3300049823 Ga0501044_0113972 Ga0501044_0113972_1735_2133 124
142 iso_pu_bacteria 8054160619 8054162077 124
143 3300013105 Ga0157369_10409184 Ga0157369_104091842 125
144 3300041413 Ga0439465_0095859 Ga0439465_0095859_78_473 125
145 3300049569 Ga0501032_0004563 Ga0501032_0004563_1252_1650 125
146 3300049569 Ga0501032_0056868 Ga0501032_0056868_307_708 125
147 3300049570 Ga0501033_0090194 Ga0501033_0090194_1171_1569 125
148 3300049570 Ga0501033_0343886 Ga0501033_0343886_576_977 125
149 3300049571 Ga0501034_0110936 Ga0501034_0110936_1714_2115 125
150 3300049571 Ga0501034_0199183 Ga0501034_0199183_371_769 125
151 3300049571 Ga0501034_0355381 Ga0501034_0355381_526_927 125
152 3300049572 Ga0501036_0013127 Ga0501036_0013127_2220_2621 125
153 3300049572 Ga0501036_0035675 Ga0501036_0035675_1777_2175 125
154 3300049573 Ga0501037_0089036 Ga0501037_0089036_678_1076 125
155 3300049573 Ga0501037_0118853 Ga0501037_0118853_1423_1824 125
156 3300049573 Ga0501037_0694465 Ga0501037_0694465_37_438 125
157 3300049574 Ga0501038_0025952 Ga0501038_0025952_3481_3879 125
158 3300049574 Ga0501038_0045941 Ga0501038_0045941_1519_1920 125
159 3300049575 Ga0501039_0034786 Ga0501039_0034786_3277_3678 125
160 3300049575 Ga0501039_0465097 Ga0501039_0465097_576_974 125
161 3300049579 Ga0501043_0004703 Ga0501043_0004703_3718_4116 125
162 3300049579 Ga0501043_0019087 Ga0501043_0019087_1726_2127 125
163 3300049579 Ga0501043_0036165 Ga0501043_0036165_1998_2399 125
164 3300049580 Ga0501046_0430284 Ga0501046_0430284_190_591 125
165 3300049581 Ga0501047_0002745 Ga0501047_0002745_9552_9950 125
166 3300049581 Ga0501047_0009998 Ga0501047_0009998_8102_8503 125
167 3300049586 Ga0501070_0001884 Ga0501070_0001884_616_1017 125
168 3300049742 Ga0501080_0263755 Ga0501080_0263755_871_1269 125
169 3300049822 Ga0501035_0003911 Ga0501035_0003911_3704_4105 125
170 3300049822 Ga0501035_0037334 Ga0501035_0037334_59_457 125
171 3300049822 Ga0501035_0086415 Ga0501035_0086415_115_516 125
172 3300049823 Ga0501044_0018101 Ga0501044_0018101_59_457 125
173 3300049823 Ga0501044_0029948 Ga0501044_0029948_3191_3592 125
174 3300049823 Ga0501044_0061781 Ga0501044_0061781_616_1017 125
175 3300049824 Ga0501045_0338332 Ga0501045_0338332_629_1030 125
176 3300048922 Ga0496119_0091263 Ga0496119_0091263_310_780 126
177 3300005466 Ga0070685_10272867 Ga0070685_102728672 127
178 3300049568 Ga0501031_0229365 Ga0501031_0229365_120_524 128
179 3300053139 Ga0500568_0145781 Ga0500568_0145781_173_622 129
180 3300046492 Ga0495585_0101830 Ga0495585_0101830_426_842 130
181 3300047317 Ga0495604_0055573 Ga0495604_0055573_2107_2523 130
182 3300047447 Ga0495685_234096 Ga0495685_234096_30_446 130
183 3300049581 Ga0501047_0100406 Ga0501047_0100406_1304_1720 130
184 3300049823 Ga0501044_0238138 Ga0501044_0238138_847_1263 130
185 3300049822 Ga0501035_0057567 Ga0501035_0057567_712_1212 134
186 3300049823 Ga0501044_0010212 Ga0501044_0010212_9115_9615 134
187 3300003320 rootH2_10010380 rootH2_100103803 138
188 3300049568 Ga0501031_0491919 Ga0501031_0491919_294_728 138
189 3300049569 Ga0501032_0122269 Ga0501032_0122269_686_1120 138
190 3300049570 Ga0501033_0123980 Ga0501033_0123980_560_994 138
191 3300049571 Ga0501034_0096154 Ga0501034_0096154_1040_1474 138
192 3300049572 Ga0501036_0184768 Ga0501036_0184768_544_978 138
193 3300049574 Ga0501038_0112147 Ga0501038_0112147_1113_1547 138
194 3300049575 Ga0501039_0326724 Ga0501039_0326724_103_537 138
195 3300049579 Ga0501043_0082733 Ga0501043_0082733_812_1246 138
196 3300049581 Ga0501047_0351034 Ga0501047_0351034_103_537 138
197 3300049823 Ga0501044_0135134 Ga0501044_0135134_1471_1905 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

19

65

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9246 20 59
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9204 19 97
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.9149 17 105
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9137 19 97
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9119 20 67
ID Description Score Start End Superfamily
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9498 19 99 3.10.290.10
af_Q2FZ78_3_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9371 19 68 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9256 20 63 1.10.1050.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9214 20 65 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9168 20 67 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A6N7FPV5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9995 18 97 GO:0003723
AF-A0A243S3J5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9896 15 99 GO:0003723
AF-A0A2E9MKS1-F1-model_v4 RNA-binding S4 domain-containing protein 0.9819 19 99 GO:0003723
AF-T1CAC2-F1-model_v4 S4 probable RNA-binding domain protein 0.9633 16 100 GO:0003723
AF-A0A843T1D0-F1-model_v4 RNA-binding protein 0.9618 17 98 GO:0003723

Feature Viewer

pLDDT pTM Quality
73.4 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map