F302313

General Info

Members Datasets Scaffolds Average Seq Length
196 147 392 355

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3004334049|3004341056
Length 372
Sequence PERQCLDECRATAPDMSGEAPFNEAFSAEDAAYAGSRFAEVRQALFANPYQQRWGETGGPALPTYKVTLLSVLSGLLPFGRAYAFRDATARAIDSSADLRWGPDNRGYRRLLHPNGICLTGMWTISEETGYSGYFQRGSQALVVARYSTCCTETRRGRSRSLSMVGKLFPTMDSDHAAPLRTANFITQQDIGGDYTSTINDAELRNAPDTTVWRRGLGAAVLLTTGIVFSIVDRKPSIRQLYPVAELGKPAGEATRAPTFMRLRVNDRQPRVAGADLDFRDEIMAQIYDAGDSAPKRKLSFDIDVTDDGETHGFPIRERRSFKNWRRVGNLVFNEAVASYNGDFVVHFPHPTWRDDQNDPATATRMHRKKVR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
113 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
144 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
147 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0.51
Rhizoplane 5.1
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 14.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019375 3300003203 Bacteria 2774
2 Ga0070690_100029003 3300005330 Bacteria 3430
3 Ga0070670_100166184 3300005331 Bacteria 1913
4 Ga0068869_100004766 3300005334 Bacteria 8468
5 Ga0070689_100141495 3300005340 Bacteria 1935
6 Ga0070661_100024308 3300005344 Bacteria 4346
7 Ga0070675_100011560 3300005354 Bacteria 6913
8 Ga0070675_100113682 3300005354 Bacteria 2293
9 Ga0070674_100228533 3300005356 Bacteria 1451
10 Ga0070673_100025062 3300005364 Bacteria 4384
11 Ga0070673_100027516 3300005364 Bacteria 4216
12 Ga0070673_100057161 3300005364 Bacteria 3081
13 Ga0070673_100126556 3300005364 Bacteria 2139
14 Ga0070688_100081954 3300005365 Bacteria 2090
15 Ga0070714_100012499 3300005435 Bacteria 6780
16 Ga0070714_100124847 3300005435 Bacteria 2293
17 Ga0070710_10080473 3300005437 Bacteria 1901
18 Ga0070711_100112275 3300005439 Unclassified 2002
19 Ga0070694_100188817 3300005444 Bacteria 1529
20 Ga0070678_100090369 3300005456 Bacteria 2347
21 Ga0068867_100005629 3300005459 Bacteria 8877
22 Ga0070685_10107528 3300005466 Unclassified 1713
23 Ga0070698_100001590 3300005471 Bacteria 25260
24 Ga0070698_100075279 3300005471 Bacteria 3380
25 Ga0070699_100012008 3300005518 Bacteria 7476
26 Ga0070697_100097841 3300005536 Bacteria 2435
27 Ga0070697_100281756 3300005536 Bacteria 1426
28 Ga0070695_100023465 3300005545 Bacteria 3792
29 Ga0070696_100003540 3300005546 Bacteria 10395
30 Ga0070665_100021139 3300005548 Bacteria 6542
31 Ga0070664_100062305 3300005564 Unclassified 3179
32 Ga0068859_100034439 3300005617 Bacteria 5083
33 Ga0068864_100066479 3300005618 Unclassified 3129
34 Ga0068866_10010829 3300005718 Bacteria 3923
35 Ga0068866_10159570 3300005718 Bacteria 1314
36 Ga0068861_100055844 3300005719 Bacteria 3012
37 Ga0068870_10071788 3300005840 Bacteria 1890
38 Ga0068863_100440461 3300005841 Unclassified 1278
39 Ga0068858_100006832 3300005842 Bacteria 11099
40 Ga0068860_100135362 3300005843 Unclassified 2366
41 Ga0068860_100539186 3300005843 Bacteria 1168
42 Ga0081538_10018719 3300005981 Bacteria 5183
43 Ga0081539_10001499 3300005985 Bacteria 39468
44 Ga0070717_10037046 3300006028 Bacteria 3959
45 Ga0070717_10095351 3300006028 Bacteria 2518
46 Ga0070717_10153513 3300006028 Bacteria 1993
47 Ga0070717_10215062 3300006028 Bacteria 1688
48 Ga0070715_10008262 3300006163 Bacteria 3621
49 Ga0070715_10029115 3300006163 Bacteria 2222
50 Ga0070712_100287210 3300006175 Unclassified 1327
51 Ga0097621_100063181 3300006237 Bacteria 3042
52 Ga0097621_100108679 3300006237 Bacteria 2342
53 Ga0068871_100008899 3300006358 Bacteria 7242
54 Ga0075428_100000056 3300006844 Bacteria 89990
55 Ga0075428_100349505 3300006844 Unclassified 1587
56 Ga0075428_100490127 3300006844 Unclassified 1315
57 Ga0075430_100001187 3300006846 Bacteria 20871
58 Ga0075431_100004917 3300006847 Bacteria 13161
59 Ga0075433_10006109 3300006852 Bacteria 9485
60 Ga0075434_100071135 3300006871 Unclassified 3469
61 Ga0075434_100293187 3300006871 Bacteria 1647
62 Ga0075429_100074930 3300006880 Unclassified 2948
63 Ga0068865_100055598 3300006881 Bacteria 2754
64 Ga0075436_100135637 3300006914 Bacteria 1728
65 Ga0097620_100034439 3300006931 Bacteria 5083
66 Ga0075435_100068919 3300007076 Unclassified 2882
67 Ga0075435_100212365 3300007076 Bacteria 1642
68 Ga0099794_10034510 3300007265 Bacteria 2384
69 Ga0105240_10102778 3300009093 Bacteria 3472
70 Ga0111539_10000002 3300009094 Bacteria 983359
71 Ga0105245_10019577 3300009098 Bacteria 5929
72 Ga0105245_10085955 3300009098 Bacteria 2884
73 Ga0114129_10004378 3300009147 Bacteria 19918
74 Ga0114129_10036702 3300009147 Bacteria 6920
75 Ga0114129_10048455 3300009147 Bacteria 5970
76 Ga0114129_10567714 3300009147 Unclassified 1474
77 Ga0105243_10025661 3300009148 Bacteria 4506
78 Ga0105243_10268273 3300009148 Bacteria 1531
79 Ga0105242_10419472 3300009176 Bacteria 1254
80 Ga0105237_10018976 3300009545 Bacteria 7106
81 Ga0105239_10204016 3300010375 Bacteria 2215
82 Ga0105239_10300900 3300010375 Bacteria 1806
83 Ga0163163_10004894 3300014325 Bacteria 11518
84 Ga0163163_10011996 3300014325 Bacteria 7885
85 Ga0157376_10030898 3300014969 Bacteria 4282
86 Ga0157376_10534500 3300014969 Unclassified 1158
87 Ga0213876_10011898 3300021384 Bacteria 4637
88 Ga0213875_10091422 3300021388 Bacteria 1419
89 Ga0207653_10007535 3300025885 Bacteria 3393
90 Ga0207692_10045938 3300025898 Bacteria 2187
91 Ga0207685_10006959 3300025905 Bacteria 3119
92 Ga0207645_10007792 3300025907 Bacteria 7536
93 Ga0207684_10029549 3300025910 Bacteria 4666
94 Ga0207693_10002515 3300025915 Bacteria 15940
95 Ga0207662_10049604 3300025918 Bacteria 2491
96 Ga0207649_10040738 3300025920 Bacteria 2825
97 Ga0207646_10236669 3300025922 Bacteria 1650
98 Ga0207681_10023179 3300025923 Bacteria 3968
99 Ga0207694_10054609 3300025924 Bacteria 3100
100 Ga0207650_10027274 3300025925 Unclassified 4087
101 Ga0207659_10020052 3300025926 Bacteria 4412
102 Ga0207659_10082968 3300025926 Bacteria 2374
103 Ga0207664_10194061 3300025929 Bacteria 1749
104 Ga0207686_10026811 3300025934 Bacteria 3367
105 Ga0207686_10047446 3300025934 Bacteria 2655
106 Ga0207709_10006778 3300025935 Bacteria 6410
107 Ga0207670_10010586 3300025936 Bacteria 5319
108 Ga0207704_10038584 3300025938 Bacteria 2772
109 Ga0207704_10045936 3300025938 Bacteria 2598
110 Ga0207704_10370885 3300025938 Bacteria 1121
111 Ga0207665_10152319 3300025939 Bacteria 1657
112 Ga0207691_10047660 3300025940 Bacteria 3932
113 Ga0207711_10059837 3300025941 Bacteria 3280
114 Ga0207689_10002769 3300025942 Bacteria 16206
115 Ga0207689_10222950 3300025942 Bacteria 1558
116 Ga0207651_10183251 3300025960 Unclassified 1663
117 Ga0207651_10207285 3300025960 Bacteria 1575
118 Ga0207677_10035611 3300026023 Bacteria 3235
119 Ga0207677_10036455 3300026023 Bacteria 3205
120 Ga0207703_10008060 3300026035 Bacteria 8326
121 Ga0207703_10017688 3300026035 Bacteria 5566
122 Ga0207703_10084335 3300026035 Bacteria 2657
123 Ga0207708_10004481 3300026075 Bacteria 10292
124 Ga0207708_10084219 3300026075 Unclassified 2445
125 Ga0207702_10268900 3300026078 Bacteria 1607
126 Ga0207641_10298321 3300026088 Unclassified 1521
127 Ga0207648_10009414 3300026089 Bacteria 9359
128 Ga0207676_10065785 3300026095 Bacteria 2888
129 Ga0207676_10210339 3300026095 Unclassified 1725
130 Ga0209588_1033937 3300027671 Bacteria 1637
131 Ga0207428_10000004 3300027907 Bacteria 727800
132 Ga0268264_10190306 3300028381 Unclassified 1870
133 Ga0265318_10004519 3300028577 Bacteria 6728
134 Ga0265330_10044898 3300031235 Bacteria 1949
135 Ga0265332_10024204 3300031238 Bacteria 2673
136 Ga0265320_10016981 3300031240 Bacteria 4056
137 Ga0265325_10031679 3300031241 Bacteria 2827
138 Ga0265340_10064224 3300031247 Bacteria 1750
139 Ga0265331_10051911 3300031250 Bacteria 1961
140 Ga0265313_10020696 3300031595 Bacteria 3621
141 Ga0265314_10015194 3300031711 Bacteria 6116
142 Ga0265342_10101559 3300031712 Bacteria 1637
143 Ga0373937_0052759 3300036401 Bacteria 3730
144 Ga0373937_0273257 3300036401 Bacteria 1595
145 Ga0373937_0428463 3300036401 Bacteria 1256
146 Ga0436364_1166643 3300037853 Bacteria 4580
147 Ga0436365_1431770 3300039437 Bacteria 5056
148 Ga0436360_0764410 3300039438 Bacteria 6387
149 Ga0436361_0866154 3300039447 Bacteria 3553
150 Ga0451849_1495531 3300041505 Unclassified 1746
151 Ga0450920_014885 3300042122 Unclassified 1476
152 Ga0450894_003012 3300042131 Unclassified 2224
153 Ga0451576_0365497 3300045051 Bacteria 1511
154 Ga0495603_0068050 3300046455 Bacteria 2095
155 Ga0495638_0025952 3300046460 Bacteria 3803
156 Ga0495638_0051703 3300046460 Bacteria 2562
157 Ga0495628_0080289 3300046516 Bacteria 2536
158 Ga0495658_0279949 3300046683 Bacteria 1052
159 Ga0495613_0201343 3300046689 Unclassified 1404
160 Ga0496100_0021644 3300048903 Bacteria 3877
161 Ga0496101_0000637 3300048904 Bacteria 21249
162 Ga0496102_0403265 3300048905 Bacteria 1285
163 Ga0496104_0054190 3300048907 Bacteria 3791
164 Ga0496105_0013078 3300048908 Bacteria 6580
165 Ga0496106_0087925 3300048909 Bacteria 2395
166 Ga0496110_0026532 3300048913 Bacteria 4959
167 Ga0496112_0475286 3300048915 Bacteria 1187
168 Ga0496113_0139951 3300048916 Bacteria 1904
169 Ga0496114_0008579 3300048917 Bacteria 8100
170 Ga0501072_0120968 3300049588 Unclassified 2086
171 Ga0501035_0041123 3300049822 Bacteria 4175
172 Ga0501045_0052011 3300049824 Bacteria 2990
173 nmdc:mga05p37_127953_c1 3300050507 Bacteria 3118
174 nmdc:mga05p37_128854_c1 3300050507 Bacteria 3106
175 nmdc:mga05p37_15062_c1 3300050507 Bacteria 9284
176 nmdc:mga09592_180_c1 3300050508 Bacteria 44933
177 nmdc:mga09592_87531_c1 3300050508 Unclassified 2659
178 nmdc:mga0qj67_7243_c1 3300050509 Bacteria 8195
179 nmdc:mga06r32_20027_c1 3300050510 Bacteria 6150
180 nmdc:mga06r32_2344_c1 3300050510 Bacteria 16984
181 nmdc:mga08y16_237710_c1 3300050511 Bacteria 1884
182 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
183 nmdc:mga0n895_12269_c1 3300050512 Bacteria 7680
184 nmdc:mga0n895_178186_c1 3300050512 Bacteria 2156
185 nmdc:mga0n895_23545_c1 3300050512 Bacteria 5789
186 nmdc:mga0rr50_250763_c1 3300050513 Bacteria 1470
187 nmdc:mga0a205_233_c1 3300050515 Bacteria 39247
188 nmdc:mga0a205_332377_c1 3300050515 Unclassified 1389
189 nmdc:mga0a205_355816_c1 3300050515 Unclassified 1331
190 Ga0495601_0156576 3300053077 Unclassified 1488
191 Ga0495619_0248648 3300053085 Bacteria 1232
192 Ga0500641_0005803 3300053096 Bacteria 4373
193 Ga0500592_010350 3300053116 Bacteria 1485
194 Ga0530510_0191052 3300061734 Bacteria 1520
195 3004341056 3004334049 Bacteria 8449246
196 8055624879 8055617313 Bacteria 7548464
197 JGI25406J46586_10019375
198 Ga0070690_100029003
199 Ga0070670_100166184
200 Ga0068869_100004766
201 Ga0070689_100141495
202 Ga0070661_100024308
203 Ga0070675_100011560
204 Ga0070675_100113682
205 Ga0070674_100228533
206 Ga0070673_100025062
207 Ga0070673_100027516
208 Ga0070673_100057161
209 Ga0070673_100126556
210 Ga0070688_100081954
211 Ga0070714_100012499
212 Ga0070714_100124847
213 Ga0070710_10080473
214 Ga0070711_100112275
215 Ga0070694_100188817
216 Ga0070678_100090369
217 Ga0068867_100005629
218 Ga0070685_10107528
219 Ga0070698_100001590
220 Ga0070698_100075279
221 Ga0070699_100012008
222 Ga0070697_100097841
223 Ga0070697_100281756
224 Ga0070695_100023465
225 Ga0070696_100003540
226 Ga0070665_100021139
227 Ga0070664_100062305
228 Ga0068859_100034439
229 Ga0068864_100066479
230 Ga0068866_10010829
231 Ga0068866_10159570
232 Ga0068861_100055844
233 Ga0068870_10071788
234 Ga0068863_100440461
235 Ga0068858_100006832
236 Ga0068860_100135362
237 Ga0068860_100539186
238 Ga0081538_10018719
239 Ga0081539_10001499
240 Ga0070717_10037046
241 Ga0070717_10095351
242 Ga0070717_10153513
243 Ga0070717_10215062
244 Ga0070715_10008262
245 Ga0070715_10029115
246 Ga0070712_100287210
247 Ga0097621_100063181
248 Ga0097621_100108679
249 Ga0068871_100008899
250 Ga0075428_100000056
251 Ga0075428_100349505
252 Ga0075428_100490127
253 Ga0075430_100001187
254 Ga0075431_100004917
255 Ga0075433_10006109
256 Ga0075434_100071135
257 Ga0075434_100293187
258 Ga0075429_100074930
259 Ga0068865_100055598
260 Ga0075436_100135637
261 Ga0097620_100034439
262 Ga0075435_100068919
263 Ga0075435_100212365
264 Ga0099794_10034510
265 Ga0105240_10102778
266 Ga0111539_10000002
267 Ga0105245_10019577
268 Ga0105245_10085955
269 Ga0114129_10004378
270 Ga0114129_10036702
271 Ga0114129_10048455
272 Ga0114129_10567714
273 Ga0105243_10025661
274 Ga0105243_10268273
275 Ga0105242_10419472
276 Ga0105237_10018976
277 Ga0105239_10204016
278 Ga0105239_10300900
279 Ga0163163_10004894
280 Ga0163163_10011996
281 Ga0157376_10030898
282 Ga0157376_10534500
283 Ga0213876_10011898
284 Ga0213875_10091422
285 Ga0207653_10007535
286 Ga0207692_10045938
287 Ga0207685_10006959
288 Ga0207645_10007792
289 Ga0207684_10029549
290 Ga0207693_10002515
291 Ga0207662_10049604
292 Ga0207649_10040738
293 Ga0207646_10236669
294 Ga0207681_10023179
295 Ga0207694_10054609
296 Ga0207650_10027274
297 Ga0207659_10020052
298 Ga0207659_10082968
299 Ga0207664_10194061
300 Ga0207686_10026811
301 Ga0207686_10047446
302 Ga0207709_10006778
303 Ga0207670_10010586
304 Ga0207704_10038584
305 Ga0207704_10045936
306 Ga0207704_10370885
307 Ga0207665_10152319
308 Ga0207691_10047660
309 Ga0207711_10059837
310 Ga0207689_10002769
311 Ga0207689_10222950
312 Ga0207651_10183251
313 Ga0207651_10207285
314 Ga0207677_10035611
315 Ga0207677_10036455
316 Ga0207703_10008060
317 Ga0207703_10017688
318 Ga0207703_10084335
319 Ga0207708_10004481
320 Ga0207708_10084219
321 Ga0207702_10268900
322 Ga0207641_10298321
323 Ga0207648_10009414
324 Ga0207676_10065785
325 Ga0207676_10210339
326 Ga0209588_1033937
327 Ga0207428_10000004
328 Ga0268264_10190306
329 Ga0265318_10004519
330 Ga0265330_10044898
331 Ga0265332_10024204
332 Ga0265320_10016981
333 Ga0265325_10031679
334 Ga0265340_10064224
335 Ga0265331_10051911
336 Ga0265313_10020696
337 Ga0265314_10015194
338 Ga0265342_10101559
339 Ga0373937_0052759
340 Ga0373937_0273257
341 Ga0373937_0428463
342 Ga0436364_1166643
343 Ga0436365_1431770
344 Ga0436360_0764410
345 Ga0436361_0866154
346 Ga0451849_1495531
347 Ga0450920_014885
348 Ga0450894_003012
349 Ga0451576_0365497
350 Ga0495603_0068050
351 Ga0495638_0025952
352 Ga0495638_0051703
353 Ga0495628_0080289
354 Ga0495658_0279949
355 Ga0495613_0201343
356 Ga0496100_0021644
357 Ga0496101_0000637
358 Ga0496102_0403265
359 Ga0496104_0054190
360 Ga0496105_0013078
361 Ga0496106_0087925
362 Ga0496110_0026532
363 Ga0496112_0475286
364 Ga0496113_0139951
365 Ga0496114_0008579
366 Ga0501072_0120968
367 Ga0501035_0041123
368 Ga0501045_0052011
369 nmdc:mga05p37_127953_c1
370 nmdc:mga05p37_128854_c1
371 nmdc:mga05p37_15062_c1
372 nmdc:mga09592_180_c1
373 nmdc:mga09592_87531_c1
374 nmdc:mga0qj67_7243_c1
375 nmdc:mga06r32_20027_c1
376 nmdc:mga06r32_2344_c1
377 nmdc:mga08y16_237710_c1
378 nmdc:mga08y16_2_c1
379 nmdc:mga0n895_12269_c1
380 nmdc:mga0n895_178186_c1
381 nmdc:mga0n895_23545_c1
382 nmdc:mga0rr50_250763_c1
383 nmdc:mga0a205_233_c1
384 nmdc:mga0a205_332377_c1
385 nmdc:mga0a205_355816_c1
386 Ga0495601_0156576
387 Ga0495619_0248648
388 Ga0500641_0005803
389 Ga0500592_010350
390 Ga0530510_0191052
391 3004341056
392 8055624879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gwe-assembly1.cif.gz_A atomic resolution structure of micrococcus lysodeikticus catalase 0.7256 92 173
1gwf-assembly1.cif.gz_A compound ii structure of micrococcus lysodeikticus catalase 0.717 92 173
1m7s-assembly1.cif.gz_C crystal structure analysis of catalase catf of pseudomonas syringae 0.6538 91 186
1hbz-assembly1.cif.gz_A catalase from micrococcus lysodeikticu 0.5659 92 221
3dy5-assembly2.cif.gz_C allene oxide synthase 8r-lipoxygenase from plexaura homomalla 0.5637 92 183
ID Description Score Start End Superfamily
1m7sC00 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.6538 91 186 2.40.180.10
3e4wB02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.6482 102 190 2.40.180.10
1ye9B02 Mainly Beta;Beta Barrel;catalase hpii fold;catalase hpii domain 0.6213 97 190 2.40.470.10
1hbzA00 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.5659 92 221 2.40.180.10
3dy5C01 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.5637 92 183 2.40.180.10
ID Description Score Start End GO Terms
AF-A0A537R4Q1-F1-model_v4 Uncharacterized protein 0.9553 9 323
AF-A0A2T2YLU6-F1-model_v4 Uncharacterized protein 0.9482 8 323
AF-A0A2V8QBV5-F1-model_v4 Uncharacterized protein 0.9469 1 259
AF-A0A537R4Q1-F1-model_v4 Uncharacterized protein 0.9291 9 323
AF-A0A2T2YLU6-F1-model_v4 Uncharacterized protein 0.9252 8 323

Map