F302059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 196 | 130 | 194 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0000007|Ga0495686_0000007_11010_11507 |
| Length | 165 |
| Sequence | MGARLHVFKTGNAEKQEKTMPNTVKLHRVFATKPEKIFKAFTDPDAKCRWLPPHGFLGQMHHHEAKVGGTYKMSFVNFSTGNGHSFGGKFVELNPERIRYTDKFDDPNMPGEMEVTVQIKKVVVGTEVHIEQKGVPDQIPVEACYLGWQQSLMQLALLVEPEIPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 2 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 102 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 106 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 107 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 108 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 109 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 110 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 111 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 120 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 121 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 122 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 123 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 124 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 125 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 126 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 127 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 128 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 129 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 130 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 0 |
| Isolates | 1.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.67 |
| Nodule | 0.51 |
| Rhizoplane | 0 |
| Rhizosphere | 89.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10006904 | 3300003215 | Bacteria | 5667 |
| 2 | rootH2_10055032 | 3300003320 | Bacteria | 2246 |
| 3 | Ga0055526_1017346 | 3300003771 | Bacteria | 2754 |
| 4 | Ga0070658_10641597 | 3300005327 | Bacteria | 921 |
| 5 | Ga0070690_100224203 | 3300005330 | Bacteria | 1318 |
| 6 | Ga0068869_100015047 | 3300005334 | Bacteria | 5178 |
| 7 | Ga0070682_101348737 | 3300005337 | Bacteria | 608 |
| 8 | Ga0070660_100067565 | 3300005339 | Bacteria | 2785 |
| 9 | Ga0070689_100031861 | 3300005340 | Bacteria | 4007 |
| 10 | Ga0070689_100045326 | 3300005340 | Bacteria | 3386 |
| 11 | Ga0070692_10157665 | 3300005345 | Bacteria | 1298 |
| 12 | Ga0070671_100410829 | 3300005355 | Bacteria | 1159 |
| 13 | Ga0070671_101076428 | 3300005355 | Bacteria | 706 |
| 14 | Ga0070688_100335534 | 3300005365 | Bacteria | 1102 |
| 15 | Ga0070713_100641636 | 3300005436 | Bacteria | 1011 |
| 16 | Ga0070710_10037330 | 3300005437 | Archaea | 2661 |
| 17 | Ga0070701_10014464 | 3300005438 | Bacteria | 3619 |
| 18 | Ga0070711_100046830 | 3300005439 | Archaea | 2949 |
| 19 | Ga0070705_100853936 | 3300005440 | Bacteria | 728 |
| 20 | Ga0070700_100152597 | 3300005441 | Bacteria | 1581 |
| 21 | Ga0070694_100107765 | 3300005444 | Bacteria | 1981 |
| 22 | Ga0070678_100656932 | 3300005456 | Bacteria | 941 |
| 23 | Ga0068867_100128616 | 3300005459 | Bacteria | 1966 |
| 24 | Ga0068867_100344378 | 3300005459 | Bacteria | 1242 |
| 25 | Ga0070679_100985646 | 3300005530 | Bacteria | 787 |
| 26 | Ga0068853_100236623 | 3300005539 | Bacteria | 1672 |
| 27 | Ga0070693_100264573 | 3300005547 | Unclassified | 1145 |
| 28 | Ga0068855_100337261 | 3300005563 | Bacteria | 1663 |
| 29 | Ga0070664_101490314 | 3300005564 | Bacteria | 640 |
| 30 | Ga0068852_100508705 | 3300005616 | Bacteria | 1200 |
| 31 | Ga0068859_100141281 | 3300005617 | Bacteria | 2481 |
| 32 | Ga0068859_102273707 | 3300005617 | Bacteria | 598 |
| 33 | Ga0068866_10348098 | 3300005718 | Bacteria | 941 |
| 34 | Ga0068866_10911595 | 3300005718 | Bacteria | 619 |
| 35 | Ga0068861_100141113 | 3300005719 | Bacteria | 1966 |
| 36 | Ga0068851_10000075 | 3300005834 | Bacteria | 56546 |
| 37 | Ga0068870_10012663 | 3300005840 | Bacteria | 3946 |
| 38 | Ga0068863_100806772 | 3300005841 | Bacteria | 936 |
| 39 | Ga0068860_101797138 | 3300005843 | Bacteria | 635 |
| 40 | Ga0068862_100132796 | 3300005844 | Bacteria | 2203 |
| 41 | Ga0097621_101097121 | 3300006237 | Bacteria | 747 |
| 42 | Ga0097621_101203232 | 3300006237 | Bacteria | 714 |
| 43 | Ga0068871_100247264 | 3300006358 | Bacteria | 1552 |
| 44 | Ga0068865_100343896 | 3300006881 | Bacteria | 1206 |
| 45 | Ga0068865_101606092 | 3300006881 | Bacteria | 584 |
| 46 | Ga0097620_100141275 | 3300006931 | Bacteria | 2481 |
| 47 | Ga0097620_102273497 | 3300006931 | Bacteria | 598 |
| 48 | Ga0105240_10000119 | 3300009093 | Bacteria | 163675 |
| 49 | Ga0105245_10565572 | 3300009098 | Bacteria | 1160 |
| 50 | Ga0105243_10024352 | 3300009148 | Bacteria | 4616 |
| 51 | Ga0105241_10112686 | 3300009174 | Bacteria | 2179 |
| 52 | Ga0105242_10072483 | 3300009176 | Bacteria | 2861 |
| 53 | Ga0105248_10094974 | 3300009177 | Bacteria | 3357 |
| 54 | Ga0105237_10022387 | 3300009545 | Bacteria | 6484 |
| 55 | Ga0105237_10085764 | 3300009545 | Bacteria | 3139 |
| 56 | Ga0105238_10134316 | 3300009551 | Bacteria | 2452 |
| 57 | Ga0105238_11426678 | 3300009551 | Bacteria | 720 |
| 58 | Ga0105249_10042560 | 3300009553 | Bacteria | 4132 |
| 59 | Ga0105239_10013881 | 3300010375 | Bacteria | 8940 |
| 60 | Ga0105239_10015429 | 3300010375 | Bacteria | 8462 |
| 61 | Ga0105239_10637906 | 3300010375 | Unclassified | 1216 |
| 62 | Ga0105246_10380705 | 3300011119 | Bacteria | 1166 |
| 63 | Ga0157371_10188695 | 3300013102 | Bacteria | 1475 |
| 64 | Ga0157371_11008192 | 3300013102 | Bacteria | 635 |
| 65 | Ga0157370_10036241 | 3300013104 | Bacteria | 4788 |
| 66 | Ga0157370_10450880 | 3300013104 | Bacteria | 1183 |
| 67 | Ga0157370_11106942 | 3300013104 | Unclassified | 716 |
| 68 | Ga0157378_10117051 | 3300013297 | Bacteria | 2451 |
| 69 | Ga0157378_10765605 | 3300013297 | Unclassified | 989 |
| 70 | Ga0157378_11798542 | 3300013297 | Bacteria | 661 |
| 71 | Ga0163162_10031079 | 3300013306 | Bacteria | 5295 |
| 72 | Ga0157372_10012402 | 3300013307 | Bacteria | 9084 |
| 73 | Ga0157372_10313935 | 3300013307 | Bacteria | 1824 |
| 74 | Ga0157372_10467722 | 3300013307 | Bacteria | 1470 |
| 75 | Ga0157372_10564887 | 3300013307 | Unclassified | 1326 |
| 76 | Ga0157372_10570876 | 3300013307 | Bacteria | 1318 |
| 77 | Ga0157372_11405405 | 3300013307 | Unclassified | 805 |
| 78 | Ga0157372_11492714 | 3300013307 | Unclassified | 779 |
| 79 | Ga0157375_10636340 | 3300013308 | Bacteria | 1224 |
| 80 | Ga0163163_10672180 | 3300014325 | Unclassified | 1099 |
| 81 | Ga0163163_12197209 | 3300014325 | Unclassified | 611 |
| 82 | Ga0157380_10977803 | 3300014326 | Bacteria | 878 |
| 83 | Ga0163161_11476930 | 3300017792 | Bacteria | 596 |
| 84 | Ga0209564_1002610 | 3300025295 | Bacteria | 13780 |
| 85 | Ga0209758_1003892 | 3300025297 | Bacteria | 13058 |
| 86 | Ga0207426_1004511 | 3300025302 | Bacteria | 6743 |
| 87 | Ga0207656_10000043 | 3300025321 | Bacteria | 53724 |
| 88 | Ga0207692_10024971 | 3300025898 | Archaea | 2785 |
| 89 | Ga0207642_10061123 | 3300025899 | Bacteria | 1750 |
| 90 | Ga0207642_10207173 | 3300025899 | Bacteria | 1087 |
| 91 | Ga0207643_10091378 | 3300025908 | Bacteria | 1775 |
| 92 | Ga0207654_10299424 | 3300025911 | Bacteria | 1093 |
| 93 | Ga0207695_10000139 | 3300025913 | Bacteria | 216873 |
| 94 | Ga0207671_10155981 | 3300025914 | Bacteria | 1766 |
| 95 | Ga0207663_10074075 | 3300025916 | Archaea | 2205 |
| 96 | Ga0207660_10977364 | 3300025917 | Bacteria | 691 |
| 97 | Ga0207662_10414672 | 3300025918 | Bacteria | 915 |
| 98 | Ga0207681_10859780 | 3300025923 | Bacteria | 759 |
| 99 | Ga0207700_10629723 | 3300025928 | Unclassified | 956 |
| 100 | Ga0207700_10809483 | 3300025928 | Bacteria | 838 |
| 101 | Ga0207644_11350329 | 3300025931 | Unclassified | 599 |
| 102 | Ga0207706_10564215 | 3300025933 | Bacteria | 979 |
| 103 | Ga0207686_10532060 | 3300025934 | Bacteria | 916 |
| 104 | Ga0207670_10031747 | 3300025936 | Bacteria | 3389 |
| 105 | Ga0207670_11042243 | 3300025936 | Bacteria | 689 |
| 106 | Ga0207704_10075270 | 3300025938 | Bacteria | 2158 |
| 107 | Ga0207704_10460413 | 3300025938 | Bacteria | 1017 |
| 108 | Ga0207689_10027659 | 3300025942 | Bacteria | 4746 |
| 109 | Ga0207689_10736475 | 3300025942 | Bacteria | 832 |
| 110 | Ga0207689_11192297 | 3300025942 | Bacteria | 641 |
| 111 | Ga0207667_10147336 | 3300025949 | Bacteria | 2423 |
| 112 | Ga0207712_10426918 | 3300025961 | Bacteria | 1119 |
| 113 | Ga0207640_10543258 | 3300025981 | Bacteria | 975 |
| 114 | Ga0207677_11290104 | 3300026023 | Bacteria | 670 |
| 115 | Ga0207703_10369710 | 3300026035 | Bacteria | 1324 |
| 116 | Ga0207639_11199080 | 3300026041 | Unclassified | 712 |
| 117 | Ga0207639_11908934 | 3300026041 | Bacteria | 555 |
| 118 | Ga0207708_10017218 | 3300026075 | Bacteria | 5439 |
| 119 | Ga0207641_10753421 | 3300026088 | Bacteria | 961 |
| 120 | Ga0207648_10165597 | 3300026089 | Bacteria | 1953 |
| 121 | Ga0207648_10233281 | 3300026089 | Bacteria | 1637 |
| 122 | Ga0207674_10161766 | 3300026116 | Bacteria | 2193 |
| 123 | Ga0207674_12190507 | 3300026116 | Bacteria | 516 |
| 124 | Ga0207675_100027565 | 3300026118 | Bacteria | 5291 |
| 125 | Ga0207683_10453637 | 3300026121 | Bacteria | 1182 |
| 126 | Ga0207698_10059146 | 3300026142 | Bacteria | 2974 |
| 127 | Ga0209995_1026491 | 3300027471 | Bacteria | 967 |
| 128 | Ga0268265_10283941 | 3300028380 | Bacteria | 1482 |
| 129 | Ga0268265_11398957 | 3300028380 | Bacteria | 702 |
| 130 | Ga0268264_11040141 | 3300028381 | Bacteria | 826 |
| 131 | Ga0268264_12416514 | 3300028381 | Bacteria | 531 |
| 132 | Ga0265327_10000906 | 3300031251 | Bacteria | 43527 |
| 133 | Ga0307412_11656990 | 3300031911 | Unclassified | 585 |
| 134 | Ga0307414_10141793 | 3300032004 | Bacteria | 1883 |
| 135 | Ga0373932_0366422 | 3300035112 | Unclassified | 551 |
| 136 | Ga0395900_0030758 | 3300037418 | Bacteria | 5514 |
| 137 | Ga0395905_1639389 | 3300037471 | Bacteria | 548 |
| 138 | Ga0451841_0689350 | 3300041498 | Unclassified | 610 |
| 139 | Ga0439433_0098908 | 3300041999 | Bacteria | 723 |
| 140 | Ga0439442_152533 | 3300042002 | Bacteria | 514 |
| 141 | Ga0439457_017397 | 3300042014 | Bacteria | 1597 |
| 142 | Ga0439434_0013567 | 3300042435 | Bacteria | 2420 |
| 143 | Ga0451577_0000837 | 3300042876 | Bacteria | 45991 |
| 144 | Ga0451577_0015185 | 3300042876 | Bacteria | 7165 |
| 145 | Ga0451577_0100412 | 3300042876 | Bacteria | 2585 |
| 146 | Ga0451577_0202319 | 3300042876 | Bacteria | 1793 |
| 147 | Ga0451577_0328762 | 3300042876 | Bacteria | 1386 |
| 148 | Ga0453683_0026055 | 3300044673 | Bacteria | 3712 |
| 149 | Ga0453683_0119393 | 3300044673 | Bacteria | 1659 |
| 150 | Ga0453683_0210418 | 3300044673 | Bacteria | 1235 |
| 151 | Ga0453683_0415317 | 3300044673 | Unclassified | 868 |
| 152 | Ga0453683_0460133 | 3300044673 | Unclassified | 823 |
| 153 | Ga0466964_0020848 | 3300044706 | Bacteria | 2528 |
| 154 | Ga0453684_0002205 | 3300044712 | Bacteria | 48429 |
| 155 | Ga0453684_0002862 | 3300044712 | Bacteria | 40526 |
| 156 | Ga0453684_0019949 | 3300044712 | Bacteria | 10164 |
| 157 | Ga0453684_0023967 | 3300044712 | Bacteria | 8948 |
| 158 | Ga0453684_0026122 | 3300044712 | Bacteria | 8451 |
| 159 | Ga0453684_0054545 | 3300044712 | Bacteria | 5206 |
| 160 | Ga0453684_0209719 | 3300044712 | Bacteria | 2265 |
| 161 | Ga0453684_0300881 | 3300044712 | Bacteria | 1823 |
| 162 | Ga0453684_0306610 | 3300044712 | Bacteria | 1803 |
| 163 | Ga0453684_0329201 | 3300044712 | Bacteria | 1728 |
| 164 | Ga0453684_0365605 | 3300044712 | Unclassified | 1623 |
| 165 | Ga0453684_0614496 | 3300044712 | Bacteria | 1190 |
| 166 | Ga0453684_1063377 | 3300044712 | Bacteria | 857 |
| 167 | Ga0453684_2384363 | 3300044712 | Bacteria | 524 |
| 168 | Ga0453684_2475015 | 3300044712 | Bacteria | 513 |
| 169 | Ga0466960_0029970 | 3300044901 | Bacteria | 2501 |
| 170 | Ga0451576_0005589 | 3300045051 | Bacteria | 15708 |
| 171 | Ga0451576_0009643 | 3300045051 | Bacteria | 11172 |
| 172 | Ga0451576_0013980 | 3300045051 | Bacteria | 8951 |
| 173 | Ga0451576_0041114 | 3300045051 | Bacteria | 4889 |
| 174 | Ga0451576_0044282 | 3300045051 | Bacteria | 4692 |
| 175 | Ga0451576_0049313 | 3300045051 | Bacteria | 4418 |
| 176 | Ga0451576_0123684 | 3300045051 | Bacteria | 2694 |
| 177 | Ga0451576_0141979 | 3300045051 | Bacteria | 2504 |
| 178 | Ga0451576_0419136 | 3300045051 | Bacteria | 1404 |
| 179 | Ga0451576_1118931 | 3300045051 | Bacteria | 824 |
| 180 | Ga0495668_0008488 | 3300046616 | Bacteria | 6402 |
| 181 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 182 | Ga0501034_1091718 | 3300049571 | Bacteria | 679 |
| 183 | Ga0500581_238955 | 3300053089 | Unclassified | 773 |
| 184 | Ga0500555_034600 | 3300053103 | Bacteria | 1422 |
| 185 | Ga0500597_316403 | 3300053120 | Bacteria | 618 |
| 186 | Ga0500607_028044 | 3300053121 | Bacteria | 3119 |
| 187 | Ga0500652_005178 | 3300053131 | Bacteria | 4085 |
| 188 | Ga0500655_096328 | 3300053133 | Unclassified | 618 |
| 189 | Ga0500559_0042152 | 3300053136 | Bacteria | 1991 |
| 190 | Ga0500568_0011610 | 3300053139 | Bacteria | 4077 |
| 191 | Ga0500604_0003930 | 3300053151 | Bacteria | 3971 |
| 192 | Ga0500636_0000673 | 3300053177 | Bacteria | 18364 |
| 193 | Ga0500611_000005 | 3300053727 | Bacteria | 228837 |
| 194 | Ga0500625_029945 | 3300053729 | Bacteria | 2585 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005564 | Ga0070664_101490314 | Ga0070664_1014903142 | 120 |
| 2 | 3300035112 | Ga0373932_0366422 | Ga0373932_0366422_109_474 | 120 |
| 3 | 3300045051 | Ga0451576_1118931 | Ga0451576_1118931_91_510 | 138 |
| 4 | iso_pu_bacteria | 2548876994 | 2550696902 | 144 |
| 5 | iso_pu_bacteria | 2929921140 | 2929921197 | 144 |
| 6 | 3300042876 | Ga0451577_0015185 | Ga0451577_0015185_1974_2417 | 146 |
| 7 | 3300044712 | Ga0453684_0019949 | Ga0453684_0019949_7907_8350 | 146 |
| 8 | 3300045051 | Ga0451576_0041114 | Ga0451576_0041114_3532_3975 | 146 |
| 9 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_11010_11507 | 146 |
| 10 | 3300003320 | rootH2_10055032 | rootH2_100550322 | 147 |
| 11 | 3300005330 | Ga0070690_100224203 | Ga0070690_1002242031 | 147 |
| 12 | 3300005334 | Ga0068869_100015047 | Ga0068869_1000150471 | 147 |
| 13 | 3300005337 | Ga0070682_101348737 | Ga0070682_1013487371 | 147 |
| 14 | 3300005340 | Ga0070689_100031861 | Ga0070689_1000318613 | 147 |
| 15 | 3300005345 | Ga0070692_10157665 | Ga0070692_101576652 | 147 |
| 16 | 3300005365 | Ga0070688_100335534 | Ga0070688_1003355342 | 147 |
| 17 | 3300005438 | Ga0070701_10014464 | Ga0070701_100144643 | 147 |
| 18 | 3300005440 | Ga0070705_100853936 | Ga0070705_1008539361 | 147 |
| 19 | 3300005441 | Ga0070700_100152597 | Ga0070700_1001525971 | 147 |
| 20 | 3300005444 | Ga0070694_100107765 | Ga0070694_1001077651 | 147 |
| 21 | 3300005456 | Ga0070678_100656932 | Ga0070678_1006569322 | 147 |
| 22 | 3300005530 | Ga0070679_100985646 | Ga0070679_1009856461 | 147 |
| 23 | 3300005617 | Ga0068859_100141281 | Ga0068859_1001412812 | 147 |
| 24 | 3300005718 | Ga0068866_10348098 | Ga0068866_103480982 | 147 |
| 25 | 3300005719 | Ga0068861_100141113 | Ga0068861_1001411132 | 147 |
| 26 | 3300005834 | Ga0068851_10000075 | Ga0068851_1000007525 | 147 |
| 27 | 3300005840 | Ga0068870_10012663 | Ga0068870_100126632 | 147 |
| 28 | 3300005844 | Ga0068862_100132796 | Ga0068862_1001327961 | 147 |
| 29 | 3300006237 | Ga0097621_101203232 | Ga0097621_1012032321 | 147 |
| 30 | 3300006358 | Ga0068871_100247264 | Ga0068871_1002472641 | 147 |
| 31 | 3300006881 | Ga0068865_101606092 | Ga0068865_1016060921 | 147 |
| 32 | 3300006931 | Ga0097620_100141275 | Ga0097620_1001412752 | 147 |
| 33 | 3300009098 | Ga0105245_10565572 | Ga0105245_105655721 | 147 |
| 34 | 3300009148 | Ga0105243_10024352 | Ga0105243_100243521 | 147 |
| 35 | 3300009176 | Ga0105242_10072483 | Ga0105242_100724832 | 147 |
| 36 | 3300009177 | Ga0105248_10094974 | Ga0105248_100949741 | 147 |
| 37 | 3300009551 | Ga0105238_11426678 | Ga0105238_114266781 | 147 |
| 38 | 3300009553 | Ga0105249_10042560 | Ga0105249_100425604 | 147 |
| 39 | 3300013297 | Ga0157378_10117051 | Ga0157378_101170511 | 147 |
| 40 | 3300013306 | Ga0163162_10031079 | Ga0163162_100310795 | 147 |
| 41 | 3300013308 | Ga0157375_10636340 | Ga0157375_106363401 | 147 |
| 42 | 3300014326 | Ga0157380_10977803 | Ga0157380_109778031 | 147 |
| 43 | 3300017792 | Ga0163161_11476930 | Ga0163161_114769301 | 147 |
| 44 | 3300025321 | Ga0207656_10000043 | Ga0207656_1000004325 | 147 |
| 45 | 3300025899 | Ga0207642_10207173 | Ga0207642_102071732 | 147 |
| 46 | 3300025908 | Ga0207643_10091378 | Ga0207643_100913782 | 147 |
| 47 | 3300025917 | Ga0207660_10977364 | Ga0207660_109773641 | 147 |
| 48 | 3300025918 | Ga0207662_10414672 | Ga0207662_104146721 | 147 |
| 49 | 3300025923 | Ga0207681_10859780 | Ga0207681_108597801 | 147 |
| 50 | 3300025934 | Ga0207686_10532060 | Ga0207686_105320601 | 147 |
| 51 | 3300025936 | Ga0207670_11042243 | Ga0207670_110422431 | 147 |
| 52 | 3300025938 | Ga0207704_10075270 | Ga0207704_100752702 | 147 |
| 53 | 3300025942 | Ga0207689_10027659 | Ga0207689_100276595 | 147 |
| 54 | 3300026023 | Ga0207677_11290104 | Ga0207677_112901041 | 147 |
| 55 | 3300026035 | Ga0207703_10369710 | Ga0207703_103697101 | 147 |
| 56 | 3300026075 | Ga0207708_10017218 | Ga0207708_100172181 | 147 |
| 57 | 3300026089 | Ga0207648_10233281 | Ga0207648_102332812 | 147 |
| 58 | 3300026118 | Ga0207675_100027565 | Ga0207675_1000275651 | 147 |
| 59 | 3300026121 | Ga0207683_10453637 | Ga0207683_104536371 | 147 |
| 60 | 3300028380 | Ga0268265_10283941 | Ga0268265_102839411 | 147 |
| 61 | 3300028381 | Ga0268264_12416514 | Ga0268264_124165141 | 147 |
| 62 | 3300031911 | Ga0307412_11656990 | Ga0307412_116569901 | 147 |
| 63 | 3300042876 | Ga0451577_0000837 | Ga0451577_0000837_4957_5400 | 147 |
| 64 | 3300044901 | Ga0466960_0029970 | Ga0466960_0029970_1423_1866 | 147 |
| 65 | 3300045051 | Ga0451576_0009643 | Ga0451576_0009643_871_1317 | 147 |
| 66 | 3300049571 | Ga0501034_1091718 | Ga0501034_1091718_177_620 | 147 |
| 67 | 3300003215 | JGI25153J46596_10006904 | JGI25153J46596_100069043 | 148 |
| 68 | 3300003771 | Ga0055526_1017346 | Ga0055526_10173461 | 148 |
| 69 | 3300005327 | Ga0070658_10641597 | Ga0070658_106415972 | 148 |
| 70 | 3300005339 | Ga0070660_100067565 | Ga0070660_1000675654 | 148 |
| 71 | 3300005340 | Ga0070689_100045326 | Ga0070689_1000453265 | 148 |
| 72 | 3300005355 | Ga0070671_100410829 | Ga0070671_1004108292 | 148 |
| 73 | 3300005355 | Ga0070671_101076428 | Ga0070671_1010764281 | 148 |
| 74 | 3300005436 | Ga0070713_100641636 | Ga0070713_1006416362 | 148 |
| 75 | 3300005437 | Ga0070710_10037330 | Ga0070710_100373301 | 148 |
| 76 | 3300005439 | Ga0070711_100046830 | Ga0070711_1000468303 | 148 |
| 77 | 3300005459 | Ga0068867_100128616 | Ga0068867_1001286162 | 148 |
| 78 | 3300005459 | Ga0068867_100344378 | Ga0068867_1003443782 | 148 |
| 79 | 3300005539 | Ga0068853_100236623 | Ga0068853_1002366233 | 148 |
| 80 | 3300005547 | Ga0070693_100264573 | Ga0070693_1002645732 | 148 |
| 81 | 3300005563 | Ga0068855_100337261 | Ga0068855_1003372612 | 148 |
| 82 | 3300005616 | Ga0068852_100508705 | Ga0068852_1005087052 | 148 |
| 83 | 3300005617 | Ga0068859_102273707 | Ga0068859_1022737071 | 148 |
| 84 | 3300005718 | Ga0068866_10911595 | Ga0068866_109115951 | 148 |
| 85 | 3300005841 | Ga0068863_100806772 | Ga0068863_1008067721 | 148 |
| 86 | 3300005843 | Ga0068860_101797138 | Ga0068860_1017971382 | 148 |
| 87 | 3300006237 | Ga0097621_101097121 | Ga0097621_1010971211 | 148 |
| 88 | 3300006881 | Ga0068865_100343896 | Ga0068865_1003438962 | 148 |
| 89 | 3300006931 | Ga0097620_102273497 | Ga0097620_1022734971 | 148 |
| 90 | 3300009093 | Ga0105240_10000119 | Ga0105240_1000011923 | 148 |
| 91 | 3300009174 | Ga0105241_10112686 | Ga0105241_101126862 | 148 |
| 92 | 3300009545 | Ga0105237_10022387 | Ga0105237_100223871 | 148 |
| 93 | 3300009545 | Ga0105237_10085764 | Ga0105237_100857643 | 148 |
| 94 | 3300009551 | Ga0105238_10134316 | Ga0105238_101343162 | 148 |
| 95 | 3300010375 | Ga0105239_10013881 | Ga0105239_100138814 | 148 |
| 96 | 3300010375 | Ga0105239_10015429 | Ga0105239_100154295 | 148 |
| 97 | 3300010375 | Ga0105239_10637906 | Ga0105239_106379061 | 148 |
| 98 | 3300011119 | Ga0105246_10380705 | Ga0105246_103807051 | 148 |
| 99 | 3300013102 | Ga0157371_10188695 | Ga0157371_101886951 | 148 |
| 100 | 3300013102 | Ga0157371_11008192 | Ga0157371_110081922 | 148 |
| 101 | 3300013104 | Ga0157370_10036241 | Ga0157370_100362413 | 148 |
| 102 | 3300013104 | Ga0157370_10450880 | Ga0157370_104508802 | 148 |
| 103 | 3300013104 | Ga0157370_11106942 | Ga0157370_111069422 | 148 |
| 104 | 3300013297 | Ga0157378_10765605 | Ga0157378_107656052 | 148 |
| 105 | 3300013297 | Ga0157378_11798542 | Ga0157378_117985421 | 148 |
| 106 | 3300013307 | Ga0157372_10012402 | Ga0157372_100124022 | 148 |
| 107 | 3300013307 | Ga0157372_10313935 | Ga0157372_103139352 | 148 |
| 108 | 3300013307 | Ga0157372_10467722 | Ga0157372_104677221 | 148 |
| 109 | 3300013307 | Ga0157372_10564887 | Ga0157372_105648872 | 148 |
| 110 | 3300013307 | Ga0157372_10570876 | Ga0157372_105708762 | 148 |
| 111 | 3300013307 | Ga0157372_11405405 | Ga0157372_114054051 | 148 |
| 112 | 3300013307 | Ga0157372_11492714 | Ga0157372_114927141 | 148 |
| 113 | 3300014325 | Ga0163163_10672180 | Ga0163163_106721802 | 148 |
| 114 | 3300014325 | Ga0163163_12197209 | Ga0163163_121972091 | 148 |
| 115 | 3300025295 | Ga0209564_1002610 | Ga0209564_10026107 | 148 |
| 116 | 3300025297 | Ga0209758_1003892 | Ga0209758_10038927 | 148 |
| 117 | 3300025302 | Ga0207426_1004511 | Ga0207426_10045118 | 148 |
| 118 | 3300025898 | Ga0207692_10024971 | Ga0207692_100249712 | 148 |
| 119 | 3300025899 | Ga0207642_10061123 | Ga0207642_100611231 | 148 |
| 120 | 3300025911 | Ga0207654_10299424 | Ga0207654_102994242 | 148 |
| 121 | 3300025913 | Ga0207695_10000139 | Ga0207695_10000139179 | 148 |
| 122 | 3300025914 | Ga0207671_10155981 | Ga0207671_101559812 | 148 |
| 123 | 3300025916 | Ga0207663_10074075 | Ga0207663_100740752 | 148 |
| 124 | 3300025928 | Ga0207700_10629723 | Ga0207700_106297231 | 148 |
| 125 | 3300025928 | Ga0207700_10809483 | Ga0207700_108094831 | 148 |
| 126 | 3300025931 | Ga0207644_11350329 | Ga0207644_113503291 | 148 |
| 127 | 3300025933 | Ga0207706_10564215 | Ga0207706_105642152 | 148 |
| 128 | 3300025936 | Ga0207670_10031747 | Ga0207670_100317474 | 148 |
| 129 | 3300025938 | Ga0207704_10460413 | Ga0207704_104604132 | 148 |
| 130 | 3300025942 | Ga0207689_10736475 | Ga0207689_107364751 | 148 |
| 131 | 3300025942 | Ga0207689_11192297 | Ga0207689_111922971 | 148 |
| 132 | 3300025949 | Ga0207667_10147336 | Ga0207667_101473364 | 148 |
| 133 | 3300025961 | Ga0207712_10426918 | Ga0207712_104269182 | 148 |
| 134 | 3300025981 | Ga0207640_10543258 | Ga0207640_105432581 | 148 |
| 135 | 3300026041 | Ga0207639_11199080 | Ga0207639_111990801 | 148 |
| 136 | 3300026041 | Ga0207639_11908934 | Ga0207639_119089341 | 148 |
| 137 | 3300026088 | Ga0207641_10753421 | Ga0207641_107534211 | 148 |
| 138 | 3300026089 | Ga0207648_10165597 | Ga0207648_101655972 | 148 |
| 139 | 3300026116 | Ga0207674_10161766 | Ga0207674_101617663 | 148 |
| 140 | 3300026116 | Ga0207674_12190507 | Ga0207674_121905071 | 148 |
| 141 | 3300026142 | Ga0207698_10059146 | Ga0207698_100591463 | 148 |
| 142 | 3300027471 | Ga0209995_1026491 | Ga0209995_10264912 | 148 |
| 143 | 3300028380 | Ga0268265_11398957 | Ga0268265_113989571 | 148 |
| 144 | 3300028381 | Ga0268264_11040141 | Ga0268264_110401411 | 148 |
| 145 | 3300031251 | Ga0265327_10000906 | Ga0265327_1000090640 | 148 |
| 146 | 3300032004 | Ga0307414_10141793 | Ga0307414_101417933 | 148 |
| 147 | 3300037418 | Ga0395900_0030758 | Ga0395900_0030758_465_914 | 148 |
| 148 | 3300037471 | Ga0395905_1639389 | Ga0395905_1639389_84_533 | 148 |
| 149 | 3300041498 | Ga0451841_0689350 | Ga0451841_0689350_68_517 | 148 |
| 150 | 3300041999 | Ga0439433_0098908 | Ga0439433_0098908_213_662 | 148 |
| 151 | 3300042002 | Ga0439442_152533 | Ga0439442_152533_47_496 | 148 |
| 152 | 3300042014 | Ga0439457_017397 | Ga0439457_017397_1074_1523 | 148 |
| 153 | 3300042435 | Ga0439434_0013567 | Ga0439434_0013567_525_974 | 148 |
| 154 | 3300042876 | Ga0451577_0100412 | Ga0451577_0100412_943_1431 | 148 |
| 155 | 3300042876 | Ga0451577_0202319 | Ga0451577_0202319_453_902 | 148 |
| 156 | 3300042876 | Ga0451577_0328762 | Ga0451577_0328762_191_640 | 148 |
| 157 | 3300044673 | Ga0453683_0026055 | Ga0453683_0026055_701_1150 | 148 |
| 158 | 3300044673 | Ga0453683_0119393 | Ga0453683_0119393_428_874 | 148 |
| 159 | 3300044673 | Ga0453683_0210418 | Ga0453683_0210418_434_883 | 148 |
| 160 | 3300044673 | Ga0453683_0415317 | Ga0453683_0415317_205_654 | 148 |
| 161 | 3300044673 | Ga0453683_0460133 | Ga0453683_0460133_26_475 | 148 |
| 162 | 3300044706 | Ga0466964_0020848 | Ga0466964_0020848_1512_1961 | 148 |
| 163 | 3300044712 | Ga0453684_0002205 | Ga0453684_0002205_35464_35913 | 148 |
| 164 | 3300044712 | Ga0453684_0002862 | Ga0453684_0002862_36970_37419 | 148 |
| 165 | 3300044712 | Ga0453684_0023967 | Ga0453684_0023967_1344_1883 | 148 |
| 166 | 3300044712 | Ga0453684_0026122 | Ga0453684_0026122_882_1331 | 148 |
| 167 | 3300044712 | Ga0453684_0054545 | Ga0453684_0054545_4619_5068 | 148 |
| 168 | 3300044712 | Ga0453684_0209719 | Ga0453684_0209719_595_1044 | 148 |
| 169 | 3300044712 | Ga0453684_0300881 | Ga0453684_0300881_125_571 | 148 |
| 170 | 3300044712 | Ga0453684_0306610 | Ga0453684_0306610_665_1114 | 148 |
| 171 | 3300044712 | Ga0453684_0329201 | Ga0453684_0329201_1041_1490 | 148 |
| 172 | 3300044712 | Ga0453684_0365605 | Ga0453684_0365605_373_903 | 148 |
| 173 | 3300044712 | Ga0453684_0614496 | Ga0453684_0614496_162_608 | 148 |
| 174 | 3300044712 | Ga0453684_1063377 | Ga0453684_1063377_277_726 | 148 |
| 175 | 3300044712 | Ga0453684_2384363 | Ga0453684_2384363_29_478 | 148 |
| 176 | 3300044712 | Ga0453684_2475015 | Ga0453684_2475015_30_479 | 148 |
| 177 | 3300045051 | Ga0451576_0005589 | Ga0451576_0005589_356_805 | 148 |
| 178 | 3300045051 | Ga0451576_0013980 | Ga0451576_0013980_8450_8896 | 148 |
| 179 | 3300045051 | Ga0451576_0044282 | Ga0451576_0044282_2086_2535 | 148 |
| 180 | 3300045051 | Ga0451576_0049313 | Ga0451576_0049313_2917_3366 | 148 |
| 181 | 3300045051 | Ga0451576_0123684 | Ga0451576_0123684_1802_2251 | 148 |
| 182 | 3300045051 | Ga0451576_0141979 | Ga0451576_0141979_1517_1966 | 148 |
| 183 | 3300045051 | Ga0451576_0419136 | Ga0451576_0419136_513_962 | 148 |
| 184 | 3300046616 | Ga0495668_0008488 | Ga0495668_0008488_3401_3850 | 148 |
| 185 | 3300053089 | Ga0500581_238955 | Ga0500581_238955_46_495 | 148 |
| 186 | 3300053103 | Ga0500555_034600 | Ga0500555_034600_27_476 | 148 |
| 187 | 3300053120 | Ga0500597_316403 | Ga0500597_316403_81_527 | 148 |
| 188 | 3300053121 | Ga0500607_028044 | Ga0500607_028044_1211_1657 | 148 |
| 189 | 3300053131 | Ga0500652_005178 | Ga0500652_005178_1872_2321 | 148 |
| 190 | 3300053133 | Ga0500655_096328 | Ga0500655_096328_95_544 | 148 |
| 191 | 3300053136 | Ga0500559_0042152 | Ga0500559_0042152_1048_1494 | 148 |
| 192 | 3300053139 | Ga0500568_0011610 | Ga0500568_0011610_1940_2389 | 148 |
| 193 | 3300053151 | Ga0500604_0003930 | Ga0500604_0003930_2719_3168 | 148 |
| 194 | 3300053177 | Ga0500636_0000673 | Ga0500636_0000673_6373_6819 | 148 |
| 195 | 3300053727 | Ga0500611_000005 | Ga0500611_000005_105235_105684 | 148 |
| 196 | 3300053729 | Ga0500625_029945 | Ga0500625_029945_552_998 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z94-assembly1.cif.gz_B | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9924 | 4 | 144 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9826 | 4 | 144 |
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9818 | 5 | 144 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9688 | 4 | 144 |
| 1z94-assembly1.cif.gz_B | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9652 | 4 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9813 | 5 | 144 | 3.30.530.20 |
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.96 | 5 | 144 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8767 | 2 | 142 | 3.30.530.20 |
| 2lghA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8553 | 5 | 142 | 3.30.530.20 |
| 3q64A00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.855 | 5 | 141 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4WXE4-F1-model_v4 | SRPBCC family protein | 0.9948 | 5 | 146 |
|
| AF-A0A2P5Z3C7-F1-model_v4 | Polyketide cyclase | 0.9946 | 5 | 147 |
|
| AF-A0A0Q6VIA6-F1-model_v4 | Toxin | 0.9943 | 5 | 147 |
|
| AF-A0A0F3L0F3-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9934 | 5 | 147 |
|
| AF-A0A023XIA1-F1-model_v4 | deleted | 0.9933 | 5 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar