F302059

General Info

Members Datasets Scaffolds Average Seq Length
196 130 194 149

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000007|Ga0495686_0000007_11010_11507
Length 165
Sequence MGARLHVFKTGNAEKQEKTMPNTVKLHRVFATKPEKIFKAFTDPDAKCRWLPPHGFLGQMHHHEAKVGGTYKMSFVNFSTGNGHSFGGKFVELNPERIRYTDKFDDPNMPGEMEVTVQIKKVVVGTEVHIEQKGVPDQIPVEACYLGWQQSLMQLALLVEPEIPD

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
120 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
121 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
122 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
125 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
128 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
129 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
130 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.67
Nodule 0.51
Rhizoplane 0
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006904 3300003215 Bacteria 5667
2 rootH2_10055032 3300003320 Bacteria 2246
3 Ga0055526_1017346 3300003771 Bacteria 2754
4 Ga0070658_10641597 3300005327 Bacteria 921
5 Ga0070690_100224203 3300005330 Bacteria 1318
6 Ga0068869_100015047 3300005334 Bacteria 5178
7 Ga0070682_101348737 3300005337 Bacteria 608
8 Ga0070660_100067565 3300005339 Bacteria 2785
9 Ga0070689_100031861 3300005340 Bacteria 4007
10 Ga0070689_100045326 3300005340 Bacteria 3386
11 Ga0070692_10157665 3300005345 Bacteria 1298
12 Ga0070671_100410829 3300005355 Bacteria 1159
13 Ga0070671_101076428 3300005355 Bacteria 706
14 Ga0070688_100335534 3300005365 Bacteria 1102
15 Ga0070713_100641636 3300005436 Bacteria 1011
16 Ga0070710_10037330 3300005437 Archaea 2661
17 Ga0070701_10014464 3300005438 Bacteria 3619
18 Ga0070711_100046830 3300005439 Archaea 2949
19 Ga0070705_100853936 3300005440 Bacteria 728
20 Ga0070700_100152597 3300005441 Bacteria 1581
21 Ga0070694_100107765 3300005444 Bacteria 1981
22 Ga0070678_100656932 3300005456 Bacteria 941
23 Ga0068867_100128616 3300005459 Bacteria 1966
24 Ga0068867_100344378 3300005459 Bacteria 1242
25 Ga0070679_100985646 3300005530 Bacteria 787
26 Ga0068853_100236623 3300005539 Bacteria 1672
27 Ga0070693_100264573 3300005547 Unclassified 1145
28 Ga0068855_100337261 3300005563 Bacteria 1663
29 Ga0070664_101490314 3300005564 Bacteria 640
30 Ga0068852_100508705 3300005616 Bacteria 1200
31 Ga0068859_100141281 3300005617 Bacteria 2481
32 Ga0068859_102273707 3300005617 Bacteria 598
33 Ga0068866_10348098 3300005718 Bacteria 941
34 Ga0068866_10911595 3300005718 Bacteria 619
35 Ga0068861_100141113 3300005719 Bacteria 1966
36 Ga0068851_10000075 3300005834 Bacteria 56546
37 Ga0068870_10012663 3300005840 Bacteria 3946
38 Ga0068863_100806772 3300005841 Bacteria 936
39 Ga0068860_101797138 3300005843 Bacteria 635
40 Ga0068862_100132796 3300005844 Bacteria 2203
41 Ga0097621_101097121 3300006237 Bacteria 747
42 Ga0097621_101203232 3300006237 Bacteria 714
43 Ga0068871_100247264 3300006358 Bacteria 1552
44 Ga0068865_100343896 3300006881 Bacteria 1206
45 Ga0068865_101606092 3300006881 Bacteria 584
46 Ga0097620_100141275 3300006931 Bacteria 2481
47 Ga0097620_102273497 3300006931 Bacteria 598
48 Ga0105240_10000119 3300009093 Bacteria 163675
49 Ga0105245_10565572 3300009098 Bacteria 1160
50 Ga0105243_10024352 3300009148 Bacteria 4616
51 Ga0105241_10112686 3300009174 Bacteria 2179
52 Ga0105242_10072483 3300009176 Bacteria 2861
53 Ga0105248_10094974 3300009177 Bacteria 3357
54 Ga0105237_10022387 3300009545 Bacteria 6484
55 Ga0105237_10085764 3300009545 Bacteria 3139
56 Ga0105238_10134316 3300009551 Bacteria 2452
57 Ga0105238_11426678 3300009551 Bacteria 720
58 Ga0105249_10042560 3300009553 Bacteria 4132
59 Ga0105239_10013881 3300010375 Bacteria 8940
60 Ga0105239_10015429 3300010375 Bacteria 8462
61 Ga0105239_10637906 3300010375 Unclassified 1216
62 Ga0105246_10380705 3300011119 Bacteria 1166
63 Ga0157371_10188695 3300013102 Bacteria 1475
64 Ga0157371_11008192 3300013102 Bacteria 635
65 Ga0157370_10036241 3300013104 Bacteria 4788
66 Ga0157370_10450880 3300013104 Bacteria 1183
67 Ga0157370_11106942 3300013104 Unclassified 716
68 Ga0157378_10117051 3300013297 Bacteria 2451
69 Ga0157378_10765605 3300013297 Unclassified 989
70 Ga0157378_11798542 3300013297 Bacteria 661
71 Ga0163162_10031079 3300013306 Bacteria 5295
72 Ga0157372_10012402 3300013307 Bacteria 9084
73 Ga0157372_10313935 3300013307 Bacteria 1824
74 Ga0157372_10467722 3300013307 Bacteria 1470
75 Ga0157372_10564887 3300013307 Unclassified 1326
76 Ga0157372_10570876 3300013307 Bacteria 1318
77 Ga0157372_11405405 3300013307 Unclassified 805
78 Ga0157372_11492714 3300013307 Unclassified 779
79 Ga0157375_10636340 3300013308 Bacteria 1224
80 Ga0163163_10672180 3300014325 Unclassified 1099
81 Ga0163163_12197209 3300014325 Unclassified 611
82 Ga0157380_10977803 3300014326 Bacteria 878
83 Ga0163161_11476930 3300017792 Bacteria 596
84 Ga0209564_1002610 3300025295 Bacteria 13780
85 Ga0209758_1003892 3300025297 Bacteria 13058
86 Ga0207426_1004511 3300025302 Bacteria 6743
87 Ga0207656_10000043 3300025321 Bacteria 53724
88 Ga0207692_10024971 3300025898 Archaea 2785
89 Ga0207642_10061123 3300025899 Bacteria 1750
90 Ga0207642_10207173 3300025899 Bacteria 1087
91 Ga0207643_10091378 3300025908 Bacteria 1775
92 Ga0207654_10299424 3300025911 Bacteria 1093
93 Ga0207695_10000139 3300025913 Bacteria 216873
94 Ga0207671_10155981 3300025914 Bacteria 1766
95 Ga0207663_10074075 3300025916 Archaea 2205
96 Ga0207660_10977364 3300025917 Bacteria 691
97 Ga0207662_10414672 3300025918 Bacteria 915
98 Ga0207681_10859780 3300025923 Bacteria 759
99 Ga0207700_10629723 3300025928 Unclassified 956
100 Ga0207700_10809483 3300025928 Bacteria 838
101 Ga0207644_11350329 3300025931 Unclassified 599
102 Ga0207706_10564215 3300025933 Bacteria 979
103 Ga0207686_10532060 3300025934 Bacteria 916
104 Ga0207670_10031747 3300025936 Bacteria 3389
105 Ga0207670_11042243 3300025936 Bacteria 689
106 Ga0207704_10075270 3300025938 Bacteria 2158
107 Ga0207704_10460413 3300025938 Bacteria 1017
108 Ga0207689_10027659 3300025942 Bacteria 4746
109 Ga0207689_10736475 3300025942 Bacteria 832
110 Ga0207689_11192297 3300025942 Bacteria 641
111 Ga0207667_10147336 3300025949 Bacteria 2423
112 Ga0207712_10426918 3300025961 Bacteria 1119
113 Ga0207640_10543258 3300025981 Bacteria 975
114 Ga0207677_11290104 3300026023 Bacteria 670
115 Ga0207703_10369710 3300026035 Bacteria 1324
116 Ga0207639_11199080 3300026041 Unclassified 712
117 Ga0207639_11908934 3300026041 Bacteria 555
118 Ga0207708_10017218 3300026075 Bacteria 5439
119 Ga0207641_10753421 3300026088 Bacteria 961
120 Ga0207648_10165597 3300026089 Bacteria 1953
121 Ga0207648_10233281 3300026089 Bacteria 1637
122 Ga0207674_10161766 3300026116 Bacteria 2193
123 Ga0207674_12190507 3300026116 Bacteria 516
124 Ga0207675_100027565 3300026118 Bacteria 5291
125 Ga0207683_10453637 3300026121 Bacteria 1182
126 Ga0207698_10059146 3300026142 Bacteria 2974
127 Ga0209995_1026491 3300027471 Bacteria 967
128 Ga0268265_10283941 3300028380 Bacteria 1482
129 Ga0268265_11398957 3300028380 Bacteria 702
130 Ga0268264_11040141 3300028381 Bacteria 826
131 Ga0268264_12416514 3300028381 Bacteria 531
132 Ga0265327_10000906 3300031251 Bacteria 43527
133 Ga0307412_11656990 3300031911 Unclassified 585
134 Ga0307414_10141793 3300032004 Bacteria 1883
135 Ga0373932_0366422 3300035112 Unclassified 551
136 Ga0395900_0030758 3300037418 Bacteria 5514
137 Ga0395905_1639389 3300037471 Bacteria 548
138 Ga0451841_0689350 3300041498 Unclassified 610
139 Ga0439433_0098908 3300041999 Bacteria 723
140 Ga0439442_152533 3300042002 Bacteria 514
141 Ga0439457_017397 3300042014 Bacteria 1597
142 Ga0439434_0013567 3300042435 Bacteria 2420
143 Ga0451577_0000837 3300042876 Bacteria 45991
144 Ga0451577_0015185 3300042876 Bacteria 7165
145 Ga0451577_0100412 3300042876 Bacteria 2585
146 Ga0451577_0202319 3300042876 Bacteria 1793
147 Ga0451577_0328762 3300042876 Bacteria 1386
148 Ga0453683_0026055 3300044673 Bacteria 3712
149 Ga0453683_0119393 3300044673 Bacteria 1659
150 Ga0453683_0210418 3300044673 Bacteria 1235
151 Ga0453683_0415317 3300044673 Unclassified 868
152 Ga0453683_0460133 3300044673 Unclassified 823
153 Ga0466964_0020848 3300044706 Bacteria 2528
154 Ga0453684_0002205 3300044712 Bacteria 48429
155 Ga0453684_0002862 3300044712 Bacteria 40526
156 Ga0453684_0019949 3300044712 Bacteria 10164
157 Ga0453684_0023967 3300044712 Bacteria 8948
158 Ga0453684_0026122 3300044712 Bacteria 8451
159 Ga0453684_0054545 3300044712 Bacteria 5206
160 Ga0453684_0209719 3300044712 Bacteria 2265
161 Ga0453684_0300881 3300044712 Bacteria 1823
162 Ga0453684_0306610 3300044712 Bacteria 1803
163 Ga0453684_0329201 3300044712 Bacteria 1728
164 Ga0453684_0365605 3300044712 Unclassified 1623
165 Ga0453684_0614496 3300044712 Bacteria 1190
166 Ga0453684_1063377 3300044712 Bacteria 857
167 Ga0453684_2384363 3300044712 Bacteria 524
168 Ga0453684_2475015 3300044712 Bacteria 513
169 Ga0466960_0029970 3300044901 Bacteria 2501
170 Ga0451576_0005589 3300045051 Bacteria 15708
171 Ga0451576_0009643 3300045051 Bacteria 11172
172 Ga0451576_0013980 3300045051 Bacteria 8951
173 Ga0451576_0041114 3300045051 Bacteria 4889
174 Ga0451576_0044282 3300045051 Bacteria 4692
175 Ga0451576_0049313 3300045051 Bacteria 4418
176 Ga0451576_0123684 3300045051 Bacteria 2694
177 Ga0451576_0141979 3300045051 Bacteria 2504
178 Ga0451576_0419136 3300045051 Bacteria 1404
179 Ga0451576_1118931 3300045051 Bacteria 824
180 Ga0495668_0008488 3300046616 Bacteria 6402
181 Ga0495686_0000007 3300047472 Bacteria 732622
182 Ga0501034_1091718 3300049571 Bacteria 679
183 Ga0500581_238955 3300053089 Unclassified 773
184 Ga0500555_034600 3300053103 Bacteria 1422
185 Ga0500597_316403 3300053120 Bacteria 618
186 Ga0500607_028044 3300053121 Bacteria 3119
187 Ga0500652_005178 3300053131 Bacteria 4085
188 Ga0500655_096328 3300053133 Unclassified 618
189 Ga0500559_0042152 3300053136 Bacteria 1991
190 Ga0500568_0011610 3300053139 Bacteria 4077
191 Ga0500604_0003930 3300053151 Bacteria 3971
192 Ga0500636_0000673 3300053177 Bacteria 18364
193 Ga0500611_000005 3300053727 Bacteria 228837
194 Ga0500625_029945 3300053729 Bacteria 2585

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_101490314 Ga0070664_1014903142 120
2 3300035112 Ga0373932_0366422 Ga0373932_0366422_109_474 120
3 3300045051 Ga0451576_1118931 Ga0451576_1118931_91_510 138
4 iso_pu_bacteria 2548876994 2550696902 144
5 iso_pu_bacteria 2929921140 2929921197 144
6 3300042876 Ga0451577_0015185 Ga0451577_0015185_1974_2417 146
7 3300044712 Ga0453684_0019949 Ga0453684_0019949_7907_8350 146
8 3300045051 Ga0451576_0041114 Ga0451576_0041114_3532_3975 146
9 3300047472 Ga0495686_0000007 Ga0495686_0000007_11010_11507 146
10 3300003320 rootH2_10055032 rootH2_100550322 147
11 3300005330 Ga0070690_100224203 Ga0070690_1002242031 147
12 3300005334 Ga0068869_100015047 Ga0068869_1000150471 147
13 3300005337 Ga0070682_101348737 Ga0070682_1013487371 147
14 3300005340 Ga0070689_100031861 Ga0070689_1000318613 147
15 3300005345 Ga0070692_10157665 Ga0070692_101576652 147
16 3300005365 Ga0070688_100335534 Ga0070688_1003355342 147
17 3300005438 Ga0070701_10014464 Ga0070701_100144643 147
18 3300005440 Ga0070705_100853936 Ga0070705_1008539361 147
19 3300005441 Ga0070700_100152597 Ga0070700_1001525971 147
20 3300005444 Ga0070694_100107765 Ga0070694_1001077651 147
21 3300005456 Ga0070678_100656932 Ga0070678_1006569322 147
22 3300005530 Ga0070679_100985646 Ga0070679_1009856461 147
23 3300005617 Ga0068859_100141281 Ga0068859_1001412812 147
24 3300005718 Ga0068866_10348098 Ga0068866_103480982 147
25 3300005719 Ga0068861_100141113 Ga0068861_1001411132 147
26 3300005834 Ga0068851_10000075 Ga0068851_1000007525 147
27 3300005840 Ga0068870_10012663 Ga0068870_100126632 147
28 3300005844 Ga0068862_100132796 Ga0068862_1001327961 147
29 3300006237 Ga0097621_101203232 Ga0097621_1012032321 147
30 3300006358 Ga0068871_100247264 Ga0068871_1002472641 147
31 3300006881 Ga0068865_101606092 Ga0068865_1016060921 147
32 3300006931 Ga0097620_100141275 Ga0097620_1001412752 147
33 3300009098 Ga0105245_10565572 Ga0105245_105655721 147
34 3300009148 Ga0105243_10024352 Ga0105243_100243521 147
35 3300009176 Ga0105242_10072483 Ga0105242_100724832 147
36 3300009177 Ga0105248_10094974 Ga0105248_100949741 147
37 3300009551 Ga0105238_11426678 Ga0105238_114266781 147
38 3300009553 Ga0105249_10042560 Ga0105249_100425604 147
39 3300013297 Ga0157378_10117051 Ga0157378_101170511 147
40 3300013306 Ga0163162_10031079 Ga0163162_100310795 147
41 3300013308 Ga0157375_10636340 Ga0157375_106363401 147
42 3300014326 Ga0157380_10977803 Ga0157380_109778031 147
43 3300017792 Ga0163161_11476930 Ga0163161_114769301 147
44 3300025321 Ga0207656_10000043 Ga0207656_1000004325 147
45 3300025899 Ga0207642_10207173 Ga0207642_102071732 147
46 3300025908 Ga0207643_10091378 Ga0207643_100913782 147
47 3300025917 Ga0207660_10977364 Ga0207660_109773641 147
48 3300025918 Ga0207662_10414672 Ga0207662_104146721 147
49 3300025923 Ga0207681_10859780 Ga0207681_108597801 147
50 3300025934 Ga0207686_10532060 Ga0207686_105320601 147
51 3300025936 Ga0207670_11042243 Ga0207670_110422431 147
52 3300025938 Ga0207704_10075270 Ga0207704_100752702 147
53 3300025942 Ga0207689_10027659 Ga0207689_100276595 147
54 3300026023 Ga0207677_11290104 Ga0207677_112901041 147
55 3300026035 Ga0207703_10369710 Ga0207703_103697101 147
56 3300026075 Ga0207708_10017218 Ga0207708_100172181 147
57 3300026089 Ga0207648_10233281 Ga0207648_102332812 147
58 3300026118 Ga0207675_100027565 Ga0207675_1000275651 147
59 3300026121 Ga0207683_10453637 Ga0207683_104536371 147
60 3300028380 Ga0268265_10283941 Ga0268265_102839411 147
61 3300028381 Ga0268264_12416514 Ga0268264_124165141 147
62 3300031911 Ga0307412_11656990 Ga0307412_116569901 147
63 3300042876 Ga0451577_0000837 Ga0451577_0000837_4957_5400 147
64 3300044901 Ga0466960_0029970 Ga0466960_0029970_1423_1866 147
65 3300045051 Ga0451576_0009643 Ga0451576_0009643_871_1317 147
66 3300049571 Ga0501034_1091718 Ga0501034_1091718_177_620 147
67 3300003215 JGI25153J46596_10006904 JGI25153J46596_100069043 148
68 3300003771 Ga0055526_1017346 Ga0055526_10173461 148
69 3300005327 Ga0070658_10641597 Ga0070658_106415972 148
70 3300005339 Ga0070660_100067565 Ga0070660_1000675654 148
71 3300005340 Ga0070689_100045326 Ga0070689_1000453265 148
72 3300005355 Ga0070671_100410829 Ga0070671_1004108292 148
73 3300005355 Ga0070671_101076428 Ga0070671_1010764281 148
74 3300005436 Ga0070713_100641636 Ga0070713_1006416362 148
75 3300005437 Ga0070710_10037330 Ga0070710_100373301 148
76 3300005439 Ga0070711_100046830 Ga0070711_1000468303 148
77 3300005459 Ga0068867_100128616 Ga0068867_1001286162 148
78 3300005459 Ga0068867_100344378 Ga0068867_1003443782 148
79 3300005539 Ga0068853_100236623 Ga0068853_1002366233 148
80 3300005547 Ga0070693_100264573 Ga0070693_1002645732 148
81 3300005563 Ga0068855_100337261 Ga0068855_1003372612 148
82 3300005616 Ga0068852_100508705 Ga0068852_1005087052 148
83 3300005617 Ga0068859_102273707 Ga0068859_1022737071 148
84 3300005718 Ga0068866_10911595 Ga0068866_109115951 148
85 3300005841 Ga0068863_100806772 Ga0068863_1008067721 148
86 3300005843 Ga0068860_101797138 Ga0068860_1017971382 148
87 3300006237 Ga0097621_101097121 Ga0097621_1010971211 148
88 3300006881 Ga0068865_100343896 Ga0068865_1003438962 148
89 3300006931 Ga0097620_102273497 Ga0097620_1022734971 148
90 3300009093 Ga0105240_10000119 Ga0105240_1000011923 148
91 3300009174 Ga0105241_10112686 Ga0105241_101126862 148
92 3300009545 Ga0105237_10022387 Ga0105237_100223871 148
93 3300009545 Ga0105237_10085764 Ga0105237_100857643 148
94 3300009551 Ga0105238_10134316 Ga0105238_101343162 148
95 3300010375 Ga0105239_10013881 Ga0105239_100138814 148
96 3300010375 Ga0105239_10015429 Ga0105239_100154295 148
97 3300010375 Ga0105239_10637906 Ga0105239_106379061 148
98 3300011119 Ga0105246_10380705 Ga0105246_103807051 148
99 3300013102 Ga0157371_10188695 Ga0157371_101886951 148
100 3300013102 Ga0157371_11008192 Ga0157371_110081922 148
101 3300013104 Ga0157370_10036241 Ga0157370_100362413 148
102 3300013104 Ga0157370_10450880 Ga0157370_104508802 148
103 3300013104 Ga0157370_11106942 Ga0157370_111069422 148
104 3300013297 Ga0157378_10765605 Ga0157378_107656052 148
105 3300013297 Ga0157378_11798542 Ga0157378_117985421 148
106 3300013307 Ga0157372_10012402 Ga0157372_100124022 148
107 3300013307 Ga0157372_10313935 Ga0157372_103139352 148
108 3300013307 Ga0157372_10467722 Ga0157372_104677221 148
109 3300013307 Ga0157372_10564887 Ga0157372_105648872 148
110 3300013307 Ga0157372_10570876 Ga0157372_105708762 148
111 3300013307 Ga0157372_11405405 Ga0157372_114054051 148
112 3300013307 Ga0157372_11492714 Ga0157372_114927141 148
113 3300014325 Ga0163163_10672180 Ga0163163_106721802 148
114 3300014325 Ga0163163_12197209 Ga0163163_121972091 148
115 3300025295 Ga0209564_1002610 Ga0209564_10026107 148
116 3300025297 Ga0209758_1003892 Ga0209758_10038927 148
117 3300025302 Ga0207426_1004511 Ga0207426_10045118 148
118 3300025898 Ga0207692_10024971 Ga0207692_100249712 148
119 3300025899 Ga0207642_10061123 Ga0207642_100611231 148
120 3300025911 Ga0207654_10299424 Ga0207654_102994242 148
121 3300025913 Ga0207695_10000139 Ga0207695_10000139179 148
122 3300025914 Ga0207671_10155981 Ga0207671_101559812 148
123 3300025916 Ga0207663_10074075 Ga0207663_100740752 148
124 3300025928 Ga0207700_10629723 Ga0207700_106297231 148
125 3300025928 Ga0207700_10809483 Ga0207700_108094831 148
126 3300025931 Ga0207644_11350329 Ga0207644_113503291 148
127 3300025933 Ga0207706_10564215 Ga0207706_105642152 148
128 3300025936 Ga0207670_10031747 Ga0207670_100317474 148
129 3300025938 Ga0207704_10460413 Ga0207704_104604132 148
130 3300025942 Ga0207689_10736475 Ga0207689_107364751 148
131 3300025942 Ga0207689_11192297 Ga0207689_111922971 148
132 3300025949 Ga0207667_10147336 Ga0207667_101473364 148
133 3300025961 Ga0207712_10426918 Ga0207712_104269182 148
134 3300025981 Ga0207640_10543258 Ga0207640_105432581 148
135 3300026041 Ga0207639_11199080 Ga0207639_111990801 148
136 3300026041 Ga0207639_11908934 Ga0207639_119089341 148
137 3300026088 Ga0207641_10753421 Ga0207641_107534211 148
138 3300026089 Ga0207648_10165597 Ga0207648_101655972 148
139 3300026116 Ga0207674_10161766 Ga0207674_101617663 148
140 3300026116 Ga0207674_12190507 Ga0207674_121905071 148
141 3300026142 Ga0207698_10059146 Ga0207698_100591463 148
142 3300027471 Ga0209995_1026491 Ga0209995_10264912 148
143 3300028380 Ga0268265_11398957 Ga0268265_113989571 148
144 3300028381 Ga0268264_11040141 Ga0268264_110401411 148
145 3300031251 Ga0265327_10000906 Ga0265327_1000090640 148
146 3300032004 Ga0307414_10141793 Ga0307414_101417933 148
147 3300037418 Ga0395900_0030758 Ga0395900_0030758_465_914 148
148 3300037471 Ga0395905_1639389 Ga0395905_1639389_84_533 148
149 3300041498 Ga0451841_0689350 Ga0451841_0689350_68_517 148
150 3300041999 Ga0439433_0098908 Ga0439433_0098908_213_662 148
151 3300042002 Ga0439442_152533 Ga0439442_152533_47_496 148
152 3300042014 Ga0439457_017397 Ga0439457_017397_1074_1523 148
153 3300042435 Ga0439434_0013567 Ga0439434_0013567_525_974 148
154 3300042876 Ga0451577_0100412 Ga0451577_0100412_943_1431 148
155 3300042876 Ga0451577_0202319 Ga0451577_0202319_453_902 148
156 3300042876 Ga0451577_0328762 Ga0451577_0328762_191_640 148
157 3300044673 Ga0453683_0026055 Ga0453683_0026055_701_1150 148
158 3300044673 Ga0453683_0119393 Ga0453683_0119393_428_874 148
159 3300044673 Ga0453683_0210418 Ga0453683_0210418_434_883 148
160 3300044673 Ga0453683_0415317 Ga0453683_0415317_205_654 148
161 3300044673 Ga0453683_0460133 Ga0453683_0460133_26_475 148
162 3300044706 Ga0466964_0020848 Ga0466964_0020848_1512_1961 148
163 3300044712 Ga0453684_0002205 Ga0453684_0002205_35464_35913 148
164 3300044712 Ga0453684_0002862 Ga0453684_0002862_36970_37419 148
165 3300044712 Ga0453684_0023967 Ga0453684_0023967_1344_1883 148
166 3300044712 Ga0453684_0026122 Ga0453684_0026122_882_1331 148
167 3300044712 Ga0453684_0054545 Ga0453684_0054545_4619_5068 148
168 3300044712 Ga0453684_0209719 Ga0453684_0209719_595_1044 148
169 3300044712 Ga0453684_0300881 Ga0453684_0300881_125_571 148
170 3300044712 Ga0453684_0306610 Ga0453684_0306610_665_1114 148
171 3300044712 Ga0453684_0329201 Ga0453684_0329201_1041_1490 148
172 3300044712 Ga0453684_0365605 Ga0453684_0365605_373_903 148
173 3300044712 Ga0453684_0614496 Ga0453684_0614496_162_608 148
174 3300044712 Ga0453684_1063377 Ga0453684_1063377_277_726 148
175 3300044712 Ga0453684_2384363 Ga0453684_2384363_29_478 148
176 3300044712 Ga0453684_2475015 Ga0453684_2475015_30_479 148
177 3300045051 Ga0451576_0005589 Ga0451576_0005589_356_805 148
178 3300045051 Ga0451576_0013980 Ga0451576_0013980_8450_8896 148
179 3300045051 Ga0451576_0044282 Ga0451576_0044282_2086_2535 148
180 3300045051 Ga0451576_0049313 Ga0451576_0049313_2917_3366 148
181 3300045051 Ga0451576_0123684 Ga0451576_0123684_1802_2251 148
182 3300045051 Ga0451576_0141979 Ga0451576_0141979_1517_1966 148
183 3300045051 Ga0451576_0419136 Ga0451576_0419136_513_962 148
184 3300046616 Ga0495668_0008488 Ga0495668_0008488_3401_3850 148
185 3300053089 Ga0500581_238955 Ga0500581_238955_46_495 148
186 3300053103 Ga0500555_034600 Ga0500555_034600_27_476 148
187 3300053120 Ga0500597_316403 Ga0500597_316403_81_527 148
188 3300053121 Ga0500607_028044 Ga0500607_028044_1211_1657 148
189 3300053131 Ga0500652_005178 Ga0500652_005178_1872_2321 148
190 3300053133 Ga0500655_096328 Ga0500655_096328_95_544 148
191 3300053136 Ga0500559_0042152 Ga0500559_0042152_1048_1494 148
192 3300053139 Ga0500568_0011610 Ga0500568_0011610_1940_2389 148
193 3300053151 Ga0500604_0003930 Ga0500604_0003930_2719_3168 148
194 3300053177 Ga0500636_0000673 Ga0500636_0000673_6373_6819 148
195 3300053727 Ga0500611_000005 Ga0500611_000005_105235_105684 148
196 3300053729 Ga0500625_029945 Ga0500625_029945_552_998 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

31

160

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9924 4 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9826 4 144
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9818 5 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9688 4 144
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9652 4 144
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9813 5 144 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.96 5 144 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8767 2 142 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8553 5 142 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.855 5 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y4WXE4-F1-model_v4 SRPBCC family protein 0.9948 5 146
AF-A0A2P5Z3C7-F1-model_v4 Polyketide cyclase 0.9946 5 147
AF-A0A0Q6VIA6-F1-model_v4 Toxin 0.9943 5 147
AF-A0A0F3L0F3-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9934 5 147
AF-A0A023XIA1-F1-model_v4 deleted 0.9933 5 147

Feature Viewer

pLDDT pTM Quality
95.48 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map