F302034

General Info

Members Datasets Scaffolds Average Seq Length
196 101 195 163

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0040084|Ga0495661_0040084_1370_1981
Length 192
Sequence MKSMCKAVGKSNPRGRERRTSIGESMKVSIKNNAQGGFTLIELATALPKFASLGGDARLASLNAAKGSLAATAAMAHGKYLVNTGAALTTLSMEGKTITYQTSFASGYPKADTGLADAAGVSDDYTVYGPNHANDANSTSTGADEIMIVPRSAASSPTGLKCFVKYKEPASATAAPTIKLGTTGTLTAADCE

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
11 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
12 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
24 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
25 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
26 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
27 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
28 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
29 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
30 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
31 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
32 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
33 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
40 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
41 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
42 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
43 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
48 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
49 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
53 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
54 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
55 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
56 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
57 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
60 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
61 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
65 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
66 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
67 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
77 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
78 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
79 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
80 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
81 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
82 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
83 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
92 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
93 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
96 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
101 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 2.55
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 3.06
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10166282 3300003322 Bacteria 3896
2 Ga0055542_1007159 3300003762 Bacteria 2300
3 Ga0070658_10362499 3300005327 Bacteria 1241
4 Ga0070658_10784653 3300005327 Bacteria 828
5 Ga0070659_100424594 3300005366 Bacteria 1125
6 Ga0070662_100203305 3300005457 Bacteria 1573
7 Ga0068855_100310322 3300005563 Bacteria 1745
8 Ga0070664_100241817 3300005564 Bacteria 1621
9 Ga0068852_100483259 3300005616 Bacteria 1231
10 Ga0105245_10657774 3300009098 Bacteria 1078
11 Ga0105242_10066071 3300009176 Bacteria 2986
12 Ga0105237_10346109 3300009545 Bacteria 1491
13 Ga0105239_10203156 3300010375 Bacteria 2220
14 Ga0157372_11180398 3300013307 Bacteria 885
15 Ga0209148_1000431 3300025254 Bacteria 46429
16 Ga0207705_10237370 3300025909 Bacteria 1388
17 Ga0207705_10538320 3300025909 Bacteria 908
18 Ga0207671_10342692 3300025914 Bacteria 1184
19 Ga0207657_10071587 3300025919 Bacteria 2936
20 Ga0207686_10052620 3300025934 Bacteria 2542
21 Ga0207679_10381536 3300025945 Bacteria 1236
22 Ga0207667_10264497 3300025949 Bacteria 1759
23 Ga0207678_10127273 3300026067 Bacteria 2173
24 Ga0207698_10321930 3300026142 Bacteria 1448
25 Ga0395899_0094125 3300037312 Bacteria 2168
26 Ga0395899_0103851 3300037312 Bacteria 2049
27 Ga0395899_0136335 3300037312 Bacteria 1749
28 Ga0395899_0307271 3300037312 Bacteria 1071
29 Ga0395900_0000149 3300037418 Bacteria 117114
30 Ga0395900_0001065 3300037418 Bacteria 35011
31 Ga0395900_0055296 3300037418 Bacteria 4087
32 Ga0395900_0111717 3300037418 Bacteria 2806
33 Ga0395900_0235438 3300037418 Bacteria 1839
34 Ga0395900_0334819 3300037418 Bacteria 1490
35 Ga0395900_0659267 3300037418 Bacteria 982
36 Ga0395898_0071127 3300037466 Bacteria 3362
37 Ga0395898_0184560 3300037466 Bacteria 1993
38 Ga0395898_0237220 3300037466 Bacteria 1739
39 Ga0395898_0275464 3300037466 Bacteria 1605
40 Ga0395898_0460068 3300037466 Bacteria 1211
41 Ga0395898_0475098 3300037466 Bacteria 1190
42 Ga0395898_1181908 3300037466 Bacteria 696
43 Ga0395898_1416179 3300037466 Bacteria 622
44 Ga0395905_0036315 3300037471 Bacteria 4627
45 Ga0395905_0156336 3300037471 Bacteria 2144
46 Ga0395905_0268178 3300037471 Bacteria 1593
47 Ga0395905_0351737 3300037471 Bacteria 1365
48 Ga0395905_0434859 3300037471 Bacteria 1209
49 Ga0395905_0628695 3300037471 Bacteria 975
50 Ga0395901_0000025 3300038443 Bacteria 263463
51 Ga0395901_0049819 3300038443 Bacteria 4352
52 Ga0395901_0060884 3300038443 Bacteria 3928
53 Ga0395901_0061232 3300038443 Bacteria 3916
54 Ga0395901_0439057 3300038443 Bacteria 1336
55 Ga0395901_0480383 3300038443 Bacteria 1267
56 Ga0395901_0541120 3300038443 Bacteria 1181
57 Ga0395901_0545790 3300038443 Bacteria 1175
58 Ga0395901_0681589 3300038443 Bacteria 1027
59 Ga0439448_0007928 3300042005 Bacteria 3094
60 Ga0439448_0027289 3300042005 Bacteria 1799
61 Ga0439450_005091 3300042008 Bacteria 2290
62 Ga0439450_045810 3300042008 Bacteria 1027
63 Ga0439455_0024323 3300042012 Bacteria 1465
64 Ga0439455_0045197 3300042012 Bacteria 1138
65 Ga0439458_0021954 3300042157 Bacteria 1480
66 Ga0439458_0059406 3300042157 Bacteria 953
67 Ga0466969_0101300 3300044656 Bacteria 1355
68 Ga0466972_0000413 3300044658 Bacteria 22325
69 Ga0466972_0101667 3300044658 Bacteria 1360
70 Ga0466965_0053303 3300044683 Bacteria 2010
71 Ga0466965_0151391 3300044683 Bacteria 1212
72 Ga0466965_0167747 3300044683 Bacteria 1153
73 Ga0466966_0039822 3300044684 Bacteria 3025
74 Ga0466966_0083696 3300044684 Bacteria 1984
75 Ga0466966_0107531 3300044684 Bacteria 1721
76 Ga0466966_0217143 3300044684 Bacteria 1155
77 Ga0466961_0046311 3300044693 Bacteria 2782
78 Ga0466963_0317872 3300044694 Bacteria 1095
79 Ga0466963_1086667 3300044694 Bacteria 563
80 Ga0466964_0003295 3300044706 Bacteria 5878
81 Ga0466964_0175149 3300044706 Bacteria 1013
82 Ga0466968_0372185 3300044735 Bacteria 697
83 Ga0466970_0428884 3300044765 Bacteria 756
84 Ga0466957_0000004 3300044842 Bacteria 106395
85 Ga0466959_0020385 3300045049 Bacteria 4884
86 Ga0466959_0055148 3300045049 Bacteria 2902
87 Ga0466958_0122548 3300045836 Bacteria 1628
88 Ga0466958_0439307 3300045836 Bacteria 844
89 Ga0466967_0008877 3300045976 Bacteria 7413
90 Ga0495617_000045 3300046452 Bacteria 116918
91 Ga0495603_0007930 3300046455 Bacteria 6407
92 Ga0495650_0003368 3300046471 Bacteria 11718
93 Ga0495605_0000179 3300046474 Bacteria 80278
94 Ga0495605_0004735 3300046474 Bacteria 7955
95 Ga0495584_0000236 3300046491 Bacteria 39815
96 Ga0495584_0002835 3300046491 Bacteria 9677
97 Ga0495584_0027291 3300046491 Bacteria 2893
98 Ga0495585_0000003 3300046492 Bacteria 406344
99 Ga0495585_0000011 3300046492 Bacteria 210440
100 Ga0495585_0002144 3300046492 Bacteria 14400
101 Ga0495585_0013042 3300046492 Bacteria 4876
102 Ga0495594_0273972 3300046499 Bacteria 961
103 Ga0495596_0001664 3300046500 Bacteria 12618
104 Ga0495596_0030548 3300046500 Bacteria 2156
105 Ga0495607_0009302 3300046501 Bacteria 6660
106 Ga0495607_0014899 3300046501 Bacteria 5053
107 Ga0495607_0018534 3300046501 Bacteria 4436
108 Ga0495606_0005132 3300046507 Bacteria 12705
109 Ga0495606_0025064 3300046507 Bacteria 4281
110 Ga0495610_0058245 3300046512 Bacteria 1849
111 Ga0495616_0000080 3300046513 Bacteria 81238
112 Ga0495616_0000426 3300046513 Bacteria 32236
113 Ga0495616_0000478 3300046513 Bacteria 30399
114 Ga0495616_0001149 3300046513 Bacteria 18706
115 Ga0495616_0013450 3300046513 Bacteria 4616
116 Ga0495631_0023606 3300046518 Bacteria 2849
117 Ga0495632_0000066 3300046519 Bacteria 115170
118 Ga0495632_0000285 3300046519 Bacteria 49299
119 Ga0495643_0000391 3300046522 Bacteria 57750
120 Ga0495643_0000544 3300046522 Bacteria 46631
121 Ga0495643_0011082 3300046522 Bacteria 5510
122 Ga0495643_0013568 3300046522 Bacteria 4870
123 Ga0495643_0279108 3300046522 Bacteria 769
124 Ga0495648_0000002 3300046524 Bacteria 593972
125 Ga0495648_0000011 3300046524 Bacteria 299518
126 Ga0495642_0000167 3300046528 Bacteria 38275
127 Ga0495642_0001236 3300046528 Bacteria 11719
128 Ga0495642_0058077 3300046528 Bacteria 1601
129 Ga0495654_0013163 3300046530 Bacteria 4431
130 Ga0495609_0000001 3300046538 Bacteria 1060094
131 Ga0495609_0005011 3300046538 Bacteria 7083
132 Ga0495597_0000074 3300046542 Bacteria 86697
133 Ga0495597_0037340 3300046542 Bacteria 2182
134 Ga0495597_0116652 3300046542 Bacteria 1115
135 Ga0495622_0000128 3300046557 Bacteria 65352
136 Ga0495633_0000050 3300046558 Bacteria 155466
137 Ga0495633_0003325 3300046558 Bacteria 10800
138 Ga0495633_0036913 3300046558 Bacteria 2340
139 Ga0495656_0011483 3300046615 Bacteria 3252
140 Ga0495668_0006140 3300046616 Bacteria 7953
141 Ga0495611_0174052 3300046648 Bacteria 1006
142 Ga0495625_0001989 3300046660 Bacteria 23071
143 Ga0495625_0002728 3300046660 Bacteria 18715
144 Ga0495661_0000206 3300046665 Bacteria 68072
145 Ga0495661_0040084 3300046665 Bacteria 2907
146 Ga0495661_0162506 3300046665 Bacteria 1197
147 Ga0495661_0306697 3300046665 Bacteria 793
148 Ga0495588_0006942 3300046674 Bacteria 5132
149 Ga0495669_0003163 3300046684 Bacteria 6778
150 Ga0495669_0033961 3300046684 Bacteria 2247
151 Ga0495670_0005980 3300046691 Bacteria 5961
152 Ga0495671_0002294 3300046692 Bacteria 12151
153 Ga0495649_0054781 3300046694 Bacteria 2156
154 Ga0495589_0000152 3300046794 Bacteria 64153
155 Ga0495589_0000349 3300046794 Bacteria 36218
156 Ga0495660_0000293 3300046810 Bacteria 46071
157 Ga0495660_0003004 3300046810 Bacteria 10529
158 Ga0495660_0003932 3300046810 Bacteria 9083
159 Ga0495683_0000378 3300047323 Bacteria 36355
160 Ga0495683_0234438 3300047323 Bacteria 812
161 Ga0495687_000027 3300047443 Bacteria 299689
162 Ga0495687_001038 3300047443 Bacteria 27582
163 Ga0495687_143869 3300047443 Bacteria 825
164 Ga0495677_0000001 3300047445 Bacteria 715000
165 Ga0495677_0000717 3300047445 Bacteria 13403
166 Ga0495677_0008923 3300047445 Bacteria 3709
167 Ga0495677_0139351 3300047445 Bacteria 931
168 Ga0495681_0023348 3300047470 Bacteria 3288
169 Ga0495626_0000037 3300048091 Bacteria 178573
170 Ga0495626_0001295 3300048091 Bacteria 20411
171 Ga0495626_0005533 3300048091 Bacteria 7350
172 Ga0495626_0012812 3300048091 Bacteria 4378
173 Ga0496102_0532095 3300048905 Bacteria 1098
174 Ga0496107_0420303 3300048910 Bacteria 994
175 Ga0496109_0089592 3300048912 Bacteria 2844
176 Ga0496112_0215093 3300048915 Bacteria 1878
177 Ga0496112_0885746 3300048915 Bacteria 815
178 Ga0496113_0000447 3300048916 Bacteria 20018
179 Ga0496122_0001169 3300048925 Bacteria 44889
180 Ga0496123_0001064 3300048926 Bacteria 41497
181 Ga0496124_0021112 3300048927 Bacteria 6005
182 Ga0496124_0078903 3300048927 Bacteria 2712
183 Ga0496124_0096177 3300048927 Bacteria 2406
184 Ga0496124_0341915 3300048927 Bacteria 1062
185 Ga0496125_0004766 3300048928 Bacteria 15455
186 Ga0496125_0320062 3300048928 Bacteria 941
187 Ga0501306_025935 3300049127 Bacteria 846
188 Ga0501308_002755 3300049128 Bacteria 1570
189 Ga0495678_000562 3300049459 Bacteria 35639
190 Ga0495678_002048 3300049459 Bacteria 14429
191 Ga0501315_021788 3300049531 Bacteria 870
192 Ga0501036_0124952 3300049572 Bacteria 2173
193 Ga0587070_103838 3300059491 Bacteria 658
194 Ga0587102_013008 3300059649 Bacteria 856
195 Ga0466962_0092940 3300061719 Bacteria 1446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0002728 Ga0495625_0002728_1977_2510 127
2 3300046810 Ga0495660_0003004 Ga0495660_0003004_655_1194 130
3 3300009098 Ga0105245_10657774 Ga0105245_106577741 133
4 3300046530 Ga0495654_0013163 Ga0495654_0013163_1670_2188 137
5 3300046691 Ga0495670_0005980 Ga0495670_0005980_4835_5353 137
6 3300046522 Ga0495643_0000544 Ga0495643_0000544_27623_28162 140
7 3300046542 Ga0495597_0000074 Ga0495597_0000074_76764_77303 140
8 3300037312 Ga0395899_0094125 Ga0395899_0094125_891_1442 143
9 3300037418 Ga0395900_0001065 Ga0395900_0001065_11525_12076 143
10 3300037466 Ga0395898_0071127 Ga0395898_0071127_2392_2943 143
11 3300037471 Ga0395905_0156336 Ga0395905_0156336_1175_1726 143
12 3300038443 Ga0395901_0061232 Ga0395901_0061232_2420_2971 143
13 3300046455 Ga0495603_0007930 Ga0495603_0007930_2559_3077 143
14 3300046492 Ga0495585_0013042 Ga0495585_0013042_1044_1562 143
15 3300046499 Ga0495594_0273972 Ga0495594_0273972_105_623 143
16 3300046513 Ga0495616_0000080 Ga0495616_0000080_19591_20109 143
17 3300046518 Ga0495631_0023606 Ga0495631_0023606_195_713 143
18 3300046519 Ga0495632_0000066 Ga0495632_0000066_19569_20087 143
19 3300046528 Ga0495642_0001236 Ga0495642_0001236_10109_10627 143
20 3300046674 Ga0495588_0006942 Ga0495588_0006942_4514_5032 143
21 3300046684 Ga0495669_0003163 Ga0495669_0003163_947_1465 143
22 3300046500 Ga0495596_0001664 Ga0495596_0001664_2036_2566 145
23 3300048927 Ga0496124_0096177 Ga0496124_0096177_466_993 145
24 3300049572 Ga0501036_0124952 Ga0501036_0124952_226_738 147
25 3300037466 Ga0395898_0184560 Ga0395898_0184560_857_1384 149
26 3300037471 Ga0395905_0434859 Ga0395905_0434859_651_1178 149
27 3300044735 Ga0466968_0372185 Ga0466968_0372185_165_680 149
28 3300048912 Ga0496109_0089592 Ga0496109_0089592_102_617 149
29 3300048915 Ga0496112_0215093 Ga0496112_0215093_740_1255 149
30 3300048916 Ga0496113_0000447 Ga0496113_0000447_8828_9343 149
31 3300048925 Ga0496122_0001169 Ga0496122_0001169_27727_28242 149
32 3300048926 Ga0496123_0001064 Ga0496123_0001064_25045_25560 149
33 3300048928 Ga0496125_0004766 Ga0496125_0004766_2618_3133 149
34 3300044656 Ga0466969_0101300 Ga0466969_0101300_360_881 150
35 3300044683 Ga0466965_0053303 Ga0466965_0053303_984_1505 150
36 3300044684 Ga0466966_0039822 Ga0466966_0039822_760_1281 150
37 3300044684 Ga0466966_0107531 Ga0466966_0107531_903_1403 150
38 3300044693 Ga0466961_0046311 Ga0466961_0046311_1689_2210 150
39 3300044706 Ga0466964_0175149 Ga0466964_0175149_85_600 150
40 3300044765 Ga0466970_0428884 Ga0466970_0428884_128_649 150
41 3300045049 Ga0466959_0020385 Ga0466959_0020385_893_1414 150
42 3300045836 Ga0466958_0439307 Ga0466958_0439307_89_688 150
43 3300061719 Ga0466962_0092940 Ga0466962_0092940_910_1431 150
44 3300009176 Ga0105242_10066071 Ga0105242_100660712 151
45 3300025934 Ga0207686_10052620 Ga0207686_100526202 151
46 3300037312 Ga0395899_0136335 Ga0395899_0136335_535_1071 151
47 3300044694 Ga0466963_0317872 Ga0466963_0317872_16_474 151
48 3300046471 Ga0495650_0003368 Ga0495650_0003368_8975_9496 151
49 3300046491 Ga0495584_0000236 Ga0495584_0000236_7027_7554 151
50 3300046492 Ga0495585_0000011 Ga0495585_0000011_74520_75047 151
51 3300046492 Ga0495585_0002144 Ga0495585_0002144_13125_13652 151
52 3300046500 Ga0495596_0030548 Ga0495596_0030548_892_1419 151
53 3300046513 Ga0495616_0001149 Ga0495616_0001149_2317_2844 151
54 3300046558 Ga0495633_0003325 Ga0495633_0003325_9559_10086 151
55 3300047323 Ga0495683_0000378 Ga0495683_0000378_20986_21513 151
56 3300046452 Ga0495617_000045 Ga0495617_000045_58578_59108 152
57 3300046492 Ga0495585_0000003 Ga0495585_0000003_202750_203280 152
58 3300046513 Ga0495616_0000478 Ga0495616_0000478_9278_9808 152
59 3300046524 Ga0495648_0000011 Ga0495648_0000011_127841_128371 152
60 3300046558 Ga0495633_0036913 Ga0495633_0036913_1288_1818 152
61 3300046648 Ga0495611_0174052 Ga0495611_0174052_453_983 152
62 3300005366 Ga0070659_100424594 Ga0070659_1004245941 153
63 3300037471 Ga0395905_0268178 Ga0395905_0268178_677_1252 153
64 3300038443 Ga0395901_0439057 Ga0395901_0439057_58_633 153
65 3300042157 Ga0439458_0021954 Ga0439458_0021954_632_1207 153
66 3300044658 Ga0466972_0000413 Ga0466972_0000413_204_704 153
67 3300044658 Ga0466972_0101667 Ga0466972_0101667_86_586 153
68 3300044694 Ga0466963_1086667 Ga0466963_1086667_42_551 153
69 3300044706 Ga0466964_0003295 Ga0466964_0003295_4258_4758 153
70 3300045976 Ga0466967_0008877 Ga0466967_0008877_1909_2409 153
71 3300046522 Ga0495643_0000391 Ga0495643_0000391_32037_32564 153
72 3300046528 Ga0495642_0000167 Ga0495642_0000167_4058_4585 153
73 3300047445 Ga0495677_0008923 Ga0495677_0008923_689_1216 153
74 3300048091 Ga0495626_0005533 Ga0495626_0005533_4301_4828 153
75 3300005616 Ga0068852_100483259 Ga0068852_1004832592 154
76 3300026142 Ga0207698_10321930 Ga0207698_103219301 154
77 3300037312 Ga0395899_0103851 Ga0395899_0103851_641_1243 154
78 3300037312 Ga0395899_0307271 Ga0395899_0307271_367_897 154
79 3300037418 Ga0395900_0055296 Ga0395900_0055296_1653_2255 154
80 3300037418 Ga0395900_0659267 Ga0395900_0659267_435_965 154
81 3300037466 Ga0395898_1181908 Ga0395898_1181908_120_650 154
82 3300037471 Ga0395905_0036315 Ga0395905_0036315_2558_3160 154
83 3300038443 Ga0395901_0049819 Ga0395901_0049819_484_1086 154
84 3300038443 Ga0395901_0681589 Ga0395901_0681589_362_892 154
85 3300042005 Ga0439448_0027289 Ga0439448_0027289_450_986 154
86 3300044683 Ga0466965_0167747 Ga0466965_0167747_560_1078 154
87 3300046474 Ga0495605_0000179 Ga0495605_0000179_58727_59263 154
88 3300046501 Ga0495607_0009302 Ga0495607_0009302_2627_3163 154
89 3300046507 Ga0495606_0005132 Ga0495606_0005132_1290_1820 154
90 3300046512 Ga0495610_0058245 Ga0495610_0058245_269_799 154
91 3300046522 Ga0495643_0011082 Ga0495643_0011082_3498_4034 154
92 3300046524 Ga0495648_0000002 Ga0495648_0000002_269246_269785 154
93 3300046538 Ga0495609_0005011 Ga0495609_0005011_2700_3239 154
94 3300046542 Ga0495597_0037340 Ga0495597_0037340_170_694 154
95 3300046542 Ga0495597_0116652 Ga0495597_0116652_160_681 154
96 3300046557 Ga0495622_0000128 Ga0495622_0000128_18270_18809 154
97 3300046558 Ga0495633_0000050 Ga0495633_0000050_144263_144802 154
98 3300046660 Ga0495625_0001989 Ga0495625_0001989_13950_14489 154
99 3300046665 Ga0495661_0306697 Ga0495661_0306697_62_601 154
100 3300046684 Ga0495669_0033961 Ga0495669_0033961_1652_2173 154
101 3300046692 Ga0495671_0002294 Ga0495671_0002294_10013_10534 154
102 3300046694 Ga0495649_0054781 Ga0495649_0054781_998_1534 154
103 3300046794 Ga0495589_0000349 Ga0495589_0000349_20921_21457 154
104 3300046810 Ga0495660_0000293 Ga0495660_0000293_35208_35744 154
105 3300047443 Ga0495687_001038 Ga0495687_001038_12608_13144 154
106 3300047445 Ga0495677_0000717 Ga0495677_0000717_7265_7801 154
107 3300048091 Ga0495626_0000037 Ga0495626_0000037_119311_119847 154
108 3300048927 Ga0496124_0341915 Ga0496124_0341915_195_722 154
109 3300049459 Ga0495678_002048 Ga0495678_002048_9493_10032 154
110 iso_pu_bacteria 8047673197 8047679319 154
111 3300037466 Ga0395898_0237220 Ga0395898_0237220_1211_1711 155
112 3300037466 Ga0395898_0460068 Ga0395898_0460068_192_719 155
113 3300038443 Ga0395901_0545790 Ga0395901_0545790_417_917 155
114 3300042008 Ga0439450_005091 Ga0439450_005091_630_1139 155
115 3300042012 Ga0439455_0024323 Ga0439455_0024323_625_1134 155
116 3300042157 Ga0439458_0059406 Ga0439458_0059406_328_912 155
117 3300045836 Ga0466958_0122548 Ga0466958_0122548_205_732 155
118 3300046513 Ga0495616_0013450 Ga0495616_0013450_3458_3991 155
119 3300046522 Ga0495643_0279108 Ga0495643_0279108_63_647 155
120 3300049127 Ga0501306_025935 Ga0501306_025935_208_726 155
121 3300049128 Ga0501308_002755 Ga0501308_002755_536_1045 155
122 3300049531 Ga0501315_021788 Ga0501315_021788_180_698 155
123 3300003762 Ga0055542_1007159 Ga0055542_10071593 156
124 3300005327 Ga0070658_10784653 Ga0070658_107846532 156
125 3300005457 Ga0070662_100203305 Ga0070662_1002033053 156
126 3300009545 Ga0105237_10346109 Ga0105237_103461092 156
127 3300010375 Ga0105239_10203156 Ga0105239_102031563 156
128 3300013307 Ga0157372_11180398 Ga0157372_111803981 156
129 3300025254 Ga0209148_1000431 Ga0209148_100043135 156
130 3300025909 Ga0207705_10538320 Ga0207705_105383202 156
131 3300025914 Ga0207671_10342692 Ga0207671_103426922 156
132 3300026067 Ga0207678_10127273 Ga0207678_101272733 156
133 3300037418 Ga0395900_0000149 Ga0395900_0000149_57363_57899 156
134 3300037418 Ga0395900_0111717 Ga0395900_0111717_1595_2128 156
135 3300037466 Ga0395898_0275464 Ga0395898_0275464_709_1317 156
136 3300037471 Ga0395905_0351737 Ga0395905_0351737_362_895 156
137 3300038443 Ga0395901_0000025 Ga0395901_0000025_67848_68384 156
138 3300038443 Ga0395901_0060884 Ga0395901_0060884_1127_1660 156
139 3300042005 Ga0439448_0007928 Ga0439448_0007928_1499_2089 156
140 3300042012 Ga0439455_0045197 Ga0439455_0045197_76_591 156
141 3300044683 Ga0466965_0151391 Ga0466965_0151391_252_782 156
142 3300044684 Ga0466966_0083696 Ga0466966_0083696_497_1027 156
143 3300044684 Ga0466966_0217143 Ga0466966_0217143_428_958 156
144 3300044842 Ga0466957_0000004 Ga0466957_0000004_100527_101057 156
145 3300045049 Ga0466959_0055148 Ga0466959_0055148_686_1216 156
146 3300046491 Ga0495584_0002835 Ga0495584_0002835_5758_6288 156
147 3300046501 Ga0495607_0014899 Ga0495607_0014899_1038_1631 156
148 3300046507 Ga0495606_0025064 Ga0495606_0025064_811_1326 156
149 3300046519 Ga0495632_0000285 Ga0495632_0000285_21265_21795 156
150 3300046522 Ga0495643_0013568 Ga0495643_0013568_2809_3402 156
151 3300046616 Ga0495668_0006140 Ga0495668_0006140_1438_1968 156
152 3300046665 Ga0495661_0040084 Ga0495661_0040084_1370_1981 156
153 3300046665 Ga0495661_0162506 Ga0495661_0162506_82_618 156
154 3300046810 Ga0495660_0003932 Ga0495660_0003932_7050_7580 156
155 3300047443 Ga0495687_143869 Ga0495687_143869_153_671 156
156 3300047445 Ga0495677_0139351 Ga0495677_0139351_311_904 156
157 3300047470 Ga0495681_0023348 Ga0495681_0023348_150_677 156
158 3300048091 Ga0495626_0012812 Ga0495626_0012812_1283_1813 156
159 3300048905 Ga0496102_0532095 Ga0496102_0532095_232_822 156
160 3300048910 Ga0496107_0420303 Ga0496107_0420303_242_832 156
161 3300048915 Ga0496112_0885746 Ga0496112_0885746_56_646 156
162 3300048927 Ga0496124_0078903 Ga0496124_0078903_2157_2675 156
163 3300049459 Ga0495678_000562 Ga0495678_000562_16927_17457 156
164 3300059491 Ga0587070_103838 Ga0587070_103838_104_640 156
165 3300059649 Ga0587102_013008 Ga0587102_013008_305_841 156
166 3300005327 Ga0070658_10362499 Ga0070658_103624991 157
167 3300005564 Ga0070664_100241817 Ga0070664_1002418172 157
168 3300025909 Ga0207705_10237370 Ga0207705_102373701 157
169 3300025919 Ga0207657_10071587 Ga0207657_100715873 157
170 3300025945 Ga0207679_10381536 Ga0207679_103815361 157
171 3300037418 Ga0395900_0235438 Ga0395900_0235438_1191_1727 157
172 3300037418 Ga0395900_0334819 Ga0395900_0334819_645_1184 157
173 3300037466 Ga0395898_0475098 Ga0395898_0475098_462_1001 157
174 3300037466 Ga0395898_1416179 Ga0395898_1416179_34_570 157
175 3300038443 Ga0395901_0541120 Ga0395901_0541120_344_883 157
176 3300042008 Ga0439450_045810 Ga0439450_045810_204_794 157
177 3300046474 Ga0495605_0004735 Ga0495605_0004735_1649_2182 157
178 3300046491 Ga0495584_0027291 Ga0495584_0027291_683_1216 157
179 3300046501 Ga0495607_0018534 Ga0495607_0018534_3325_3858 157
180 3300046513 Ga0495616_0000426 Ga0495616_0000426_7044_7577 157
181 3300046528 Ga0495642_0058077 Ga0495642_0058077_116_649 157
182 3300046538 Ga0495609_0000001 Ga0495609_0000001_440999_441532 157
183 3300046615 Ga0495656_0011483 Ga0495656_0011483_110_643 157
184 3300046665 Ga0495661_0000206 Ga0495661_0000206_53079_53612 157
185 3300046794 Ga0495589_0000152 Ga0495589_0000152_21012_21545 157
186 3300047323 Ga0495683_0234438 Ga0495683_0234438_120_653 157
187 3300047443 Ga0495687_000027 Ga0495687_000027_99271_99804 157
188 3300047445 Ga0495677_0000001 Ga0495677_0000001_99352_99885 157
189 3300048091 Ga0495626_0001295 Ga0495626_0001295_12501_13034 157
190 3300005563 Ga0068855_100310322 Ga0068855_1003103223 158
191 3300025949 Ga0207667_10264497 Ga0207667_102644972 158
192 3300037471 Ga0395905_0628695 Ga0395905_0628695_171_707 158
193 3300038443 Ga0395901_0480383 Ga0395901_0480383_106_642 158
194 3300048927 Ga0496124_0021112 Ga0496124_0021112_5267_5776 158
195 3300048928 Ga0496125_0320062 Ga0496125_0320062_313_822 158
196 3300003322 rootL2_10166282 rootL2_101662823 160

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fda-assembly1.cif.gz_A-2 crystal structure of saccharomyces cerevisiae 3-oxoacyl-[acyl-carrier-protein] reductase complexed with nadp 0.5496 135 158
8dlc-assembly1.cif.gz_A-2 crystal structure of chalcone-isomerase like protein from vitis vinifera (vvchil) 0.5292 116 159
3vza-assembly1.cif.gz_B crystal structure of the chicken spc24-spc25 globular domain in complex with cenp-t peptide 0.5281 101 152
3kz1-assembly1.cif.gz_A crystal structure of the complex of pdz-rhogef dh/ph domains with gtp-gamma-s activated rhoa 0.5255 135 158
4aby-assembly4.cif.gz_D crystal structure of deinococcus radiodurans recn head domain 0.5255 119 159
ID Description Score Start End Superfamily
af_C6TE45_190_303_3.20.180.10 Alpha Beta;Alpha-Beta Barrel;Split barrel-like;PNP-oxidase-like 0.6229 114 153 3.20.180.10
af_B0G180_4_164_2.60.40.1970 Mainly Beta;Sandwich;Immunoglobulin-like;YEATS domain 0.599 117 154 2.60.40.1970
af_Q06632_563_897_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5586 114 152 2.130.10.10
4g73A00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.5552 134 156 3.50.50.100
af_Q5VQZ6_63_456_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.549 115 152 2.120.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3HKG3-F1-model_v4 deleted 0.8739 20 160
AF-A0A0K1JW73-F1-model_v4 Uncharacterized protein 0.8125 11 153 GO:0016020
AF-A0A7X4GR89-F1-model_v4 Prepilin-type N-terminal cleavage/methylation domain-containing protein 0.8063 9 153 GO:0016020
AF-A0A7W2EJ33-F1-model_v4 Type II secretion system protein 0.8005 10 156 GO:0016020
AF-A0A7G5ZDV3-F1-model_v4 Type II secretion system protein 0.7974 1 160 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.72 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map