F301882

General Info

Members Datasets Scaffolds Average Seq Length
196 147 392 166

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1186072|Ga0436363_1186072_48_623
Length 191
Sequence MPPKPKVPGLIKGLGVTFKEMTKTMFPNEGLKKLVPAPSKGAHTVQYPHVKEAPPTRARGVIALLEENCTVCMLCVRSCPDWCIYIEGHKYKAPPRREGGKPRTVSALDRFDIDYALCMYCGICVEVCPFDALFWSPEYEYSEINIADLLHDKTRLGEWMDTVPEPPAAEAGSEVKTKKYASPAAARAKNK

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
88 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
89 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
142 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
143 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.69
Nodule 0
Rhizoplane 7.65
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1186072 3300039450 Bacteria 641
2 Ga0070683_100856571 3300005329 Bacteria 872
3 Ga0070687_100395507 3300005343 Bacteria 905
4 Ga0070687_100528751 3300005343 Bacteria 799
5 Ga0070661_100906983 3300005344 Bacteria 728
6 Ga0070688_100617192 3300005365 Bacteria 832
7 Ga0070701_10144077 3300005438 Bacteria 1366
8 Ga0070705_100281566 3300005440 Bacteria 1182
9 Ga0070700_100037094 3300005441 Bacteria 2962
10 Ga0070708_100017962 3300005445 Bacteria 5914
11 Ga0070708_100493763 3300005445 Bacteria 1155
12 Ga0070681_10401151 3300005458 Bacteria 1283
13 Ga0068867_100765985 3300005459 Bacteria 858
14 Ga0070707_101385644 3300005468 Bacteria 670
15 Ga0070698_101235620 3300005471 Bacteria 697
16 Ga0070695_100088837 3300005545 Bacteria 2059
17 Ga0070695_100434080 3300005545 Bacteria 1003
18 Ga0070693_100370774 3300005547 Bacteria 985
19 Ga0070665_101138788 3300005548 Bacteria 791
20 Ga0068861_100346878 3300005719 Bacteria 1301
21 Ga0068860_100006205 3300005843 Bacteria 12016
22 Ga0075365_10436455 3300006038 Bacteria 925
23 Ga0075363_100065362 3300006048 Bacteria 1967
24 Ga0075364_10314294 3300006051 Bacteria 1067
25 Ga0075362_10208350 3300006177 Bacteria 953
26 Ga0075367_10175192 3300006178 Bacteria 1336
27 Ga0075367_10315621 3300006178 Bacteria 985
28 Ga0075367_10391455 3300006178 Bacteria 879
29 Ga0097621_100277037 3300006237 Bacteria 1476
30 Ga0075370_10214457 3300006353 Bacteria 1137
31 Ga0075428_102257372 3300006844 Bacteria 561
32 Ga0111539_10242892 3300009094 Bacteria 2096
33 Ga0105245_10022572 3300009098 Bacteria 5524
34 Ga0105245_10023564 3300009098 Bacteria 5403
35 Ga0105245_10272687 3300009098 Bacteria 1651
36 Ga0105245_10604515 3300009098 Bacteria 1123
37 Ga0114129_12827613 3300009147 Bacteria 576
38 Ga0105243_10569158 3300009148 Bacteria 1086
39 Ga0105241_10042483 3300009174 Bacteria 3440
40 Ga0105237_10665766 3300009545 Bacteria 1048
41 Ga0105249_10720762 3300009553 Bacteria 1058
42 Ga0105249_10737055 3300009553 Bacteria 1047
43 Ga0105249_11122295 3300009553 Bacteria 857
44 Ga0157371_10505970 3300013102 Bacteria 892
45 Ga0157374_10653016 3300013296 Bacteria 1064
46 Ga0157378_10115778 3300013297 Bacteria 2464
47 Ga0157378_10217631 3300013297 Bacteria 1814
48 Ga0157378_10228500 3300013297 Bacteria 1772
49 Ga0157375_11013136 3300013308 Bacteria 970
50 Ga0157377_10408145 3300014745 Bacteria 927
51 Ga0157379_10973603 3300014968 Bacteria 808
52 Ga0157379_11349216 3300014968 Bacteria 690
53 Ga0163161_10454160 3300017792 Bacteria 1036
54 Ga0207705_11166389 3300025909 Bacteria 592
55 Ga0207654_10286392 3300025911 Bacteria 1116
56 Ga0207707_10149090 3300025912 Bacteria 2045
57 Ga0207707_10594728 3300025912 Bacteria 937
58 Ga0207663_10348028 3300025916 Bacteria 1121
59 Ga0207652_11786930 3300025921 Bacteria 520
60 Ga0207646_10791242 3300025922 Bacteria 845
61 Ga0207687_10021549 3300025927 Bacteria 4283
62 Ga0207706_10693713 3300025933 Bacteria 870
63 Ga0207670_10392603 3300025936 Bacteria 1108
64 Ga0207711_10562154 3300025941 Bacteria 1064
65 Ga0207661_11055807 3300025944 Bacteria 748
66 Ga0207712_10560597 3300025961 Bacteria 984
67 Ga0207678_10900180 3300026067 Bacteria 782
68 Ga0207708_10101782 3300026075 Bacteria 2224
69 Ga0207648_10159947 3300026089 Bacteria 1989
70 Ga0207675_100113351 3300026118 Bacteria 2560
71 Ga0207675_100541751 3300026118 Bacteria 1162
72 Ga0207675_101480301 3300026118 Bacteria 700
73 Ga0207428_11234964 3300027907 Bacteria 519
74 Ga0268264_10038286 3300028381 Bacteria 3957
75 Ga0265325_10217311 3300031241 Bacteria 876
76 Ga0265327_10003642 3300031251 Bacteria 14492
77 Ga0265327_10219790 3300031251 Bacteria 855
78 Ga0316579_10046460 3300031691 Bacteria 2026
79 Ga0265342_10138383 3300031712 Bacteria 1360
80 Ga0316576_10001293 3300031727 Bacteria 13302
81 Ga0316578_10031602 3300031728 Bacteria 3018
82 Ga0316577_10000860 3300031733 Bacteria 13288
83 Ga0307406_10182197 3300031901 Bacteria 1530
84 Ga0307407_10211043 3300031903 Bacteria 1307
85 Ga0307409_100017516 3300031995 Bacteria 4779
86 Ga0307411_10215393 3300032005 Bacteria 1486
87 Ga0307415_100051287 3300032126 Bacteria 2799
88 Ga0307415_101060530 3300032126 Bacteria 756
89 Ga0316585_10034877 3300032137 Bacteria 1592
90 Ga0373941_0159780 3300035115 Bacteria 833
91 Ga0373943_0045187 3300035170 Bacteria 2146
92 Ga0373946_0155503 3300035171 Bacteria 1070
93 Ga0316574_0002541 3300035398 Bacteria 9176
94 Ga0316574_0129409 3300035398 Bacteria 1624
95 Ga0316574_0214872 3300035398 Bacteria 1233
96 Ga0373935_0150258 3300035692 Bacteria 1580
97 Ga0373927_0044813 3300035695 Bacteria 2862
98 Ga0373947_0244874 3300035725 Bacteria 1184
99 Ga0373937_0190693 3300036401 Bacteria 1926
100 Ga0316582_0059075 3300036647 Bacteria 2454
101 Ga0316584_0000507 3300036712 Bacteria 20573
102 Ga0316584_0072756 3300036712 Bacteria 2576
103 Ga0316584_0164507 3300036712 Bacteria 1647
104 Ga0400483_045014 3300039062 Bacteria 6101
105 Ga0436365_0354478 3300039437 Bacteria 716
106 Ga0436365_1205939 3300039437 Bacteria 1981
107 Ga0436365_1308611 3300039437 Bacteria 596
108 Ga0436365_1723786 3300039437 Bacteria 5166
109 Ga0436360_0030020 3300039438 Bacteria 723
110 Ga0436360_0191392 3300039438 Bacteria 652
111 Ga0436360_0353664 3300039438 Bacteria 796
112 Ga0436362_0426280 3300039453 Bacteria 891
113 Ga0436362_1082493 3300039453 Bacteria 736
114 Ga0436362_1184616 3300039453 Bacteria 5053
115 Ga0439465_0203427 3300041413 Bacteria 722
116 Ga0451791_1577216 3300041451 Bacteria 1159
117 Ga0451835_0200535 3300041492 Bacteria 590
118 Ga0439446_0093291 3300042156 Bacteria 945
119 Ga0451577_0001387 3300042876 Bacteria 32416
120 Ga0453684_0003331 3300044712 Bacteria 36455
121 Ga0466960_0172873 3300044901 Bacteria 1167
122 Ga0466967_1083303 3300045976 Bacteria 798
123 Ga0495629_0162976 3300046459 Bacteria 1549
124 Ga0495629_0263868 3300046459 Bacteria 1183
125 Ga0495582_0418290 3300046473 Bacteria 773
126 Ga0495630_0132509 3300046517 Bacteria 1893
127 Ga0495630_0209185 3300046517 Bacteria 1489
128 Ga0495666_0194377 3300046526 Bacteria 934
129 Ga0495665_0143785 3300046531 Bacteria 1246
130 Ga0495640_0111478 3300046533 Bacteria 1788
131 Ga0495621_0055107 3300046539 Bacteria 1430
132 Ga0495634_0177609 3300046642 Bacteria 1335
133 Ga0495588_0452772 3300046674 Bacteria 673
134 Ga0495658_0208881 3300046683 Bacteria 1219
135 Ga0495613_0000685 3300046689 Bacteria 26812
136 Ga0495613_0304678 3300046689 Bacteria 1102
137 Ga0495624_0237717 3300046690 Bacteria 1103
138 Ga0495674_0273633 3300047319 Bacteria 1385
139 Ga0495676_0338160 3300047321 Bacteria 1008
140 Ga0495676_0639842 3300047321 Bacteria 691
141 Ga0495680_0121145 3300047322 Bacteria 1931
142 Ga0495680_0305630 3300047322 Bacteria 1116
143 Ga0495680_0460514 3300047322 Bacteria 869
144 Ga0495680_0537906 3300047322 Bacteria 789
145 Ga0495684_0113444 3300047471 Bacteria 2044
146 Ga0495593_0327953 3300047673 Bacteria 765
147 Ga0496100_1108970 3300048903 Bacteria 624
148 Ga0496102_0325835 3300048905 Bacteria 1447
149 Ga0496105_0096994 3300048908 Bacteria 2435
150 Ga0496108_0113522 3300048911 Bacteria 2318
151 Ga0496108_0358891 3300048911 Bacteria 1272
152 Ga0496109_0004708 3300048912 Bacteria 11390
153 Ga0496109_1770413 3300048912 Bacteria 551
154 Ga0496110_0004705 3300048913 Bacteria 10615
155 Ga0496110_0235224 3300048913 Bacteria 1667
156 Ga0496111_0260365 3300048914 Bacteria 1287
157 Ga0496112_0003736 3300048915 Bacteria 12712
158 Ga0496112_0110476 3300048915 Bacteria 2719
159 Ga0496114_0083554 3300048917 Bacteria 2702
160 Ga0496114_0262290 3300048917 Bacteria 1521
161 Ga0501033_0000587 3300049570 Bacteria 33655
162 Ga0501038_0391253 3300049574 Bacteria 1077
163 Ga0501040_0048900 3300049576 Bacteria 2891
164 Ga0501069_0083587 3300049585 Bacteria 1800
165 Ga0501069_0483322 3300049585 Bacteria 738
166 Ga0501071_0082096 3300049587 Bacteria 2360
167 Ga0501072_0001973 3300049588 Bacteria 15290
168 Ga0501072_0100115 3300049588 Bacteria 2304
169 Ga0501072_0269405 3300049588 Bacteria 1355
170 Ga0501073_0131497 3300049589 Bacteria 1735
171 Ga0501074_0328645 3300049590 Bacteria 1085
172 Ga0501076_0113805 3300049592 Bacteria 2189
173 Ga0501080_0181034 3300049742 Bacteria 1939
174 Ga0501080_0587743 3300049742 Bacteria 989
175 Ga0501044_0003952 3300049823 Bacteria 16601
176 Ga0501045_0082699 3300049824 Bacteria 2368
177 nmdc:mga03683_195213_c1 3300050489 Bacteria 927
178 nmdc:mga00v17_1356_c1 3300050491 Bacteria 12814
179 nmdc:mga0yw44_111212_c2 3300050492 Bacteria 1227
180 nmdc:mga06z11_142508_c1 3300050494 Bacteria 1356
181 nmdc:mga06z11_196332_c1 3300050494 Bacteria 1170
182 nmdc:mga06z11_43820_c2 3300050494 Bacteria 1380
183 nmdc:mga04h51_187316_c1 3300050495 Bacteria 808
184 nmdc:mga07m45_243587_c1 3300050496 Bacteria 1046
185 nmdc:mga05p37_1858050_c1 3300050507 Bacteria 578
186 nmdc:mga08y16_94273_c1 3300050511 Bacteria 3118
187 nmdc:mga0n895_288296_c1 3300050512 Bacteria 1664
188 nmdc:mga0n895_55236_c1 3300050512 Bacteria 3908
189 Ga0500646_0087860 3300053090 Unclassified 958
190 Ga0500641_0015415 3300053096 Unclassified 2836
191 Ga0500604_0077162 3300053151 Bacteria 1071
192 Ga0501084_0000009 3300054114 Bacteria 194961
193 Ga0501084_0969790 3300054114 Bacteria 715
194 Ga0587115_075975 3300059626 Bacteria 588
195 Ga0587069_048426 3300059642 Bacteria 749
196 Ga0501082_0027672 3300060353 Bacteria 4880
197 Ga0436363_1186072
198 Ga0070683_100856571
199 Ga0070687_100395507
200 Ga0070687_100528751
201 Ga0070661_100906983
202 Ga0070688_100617192
203 Ga0070701_10144077
204 Ga0070705_100281566
205 Ga0070700_100037094
206 Ga0070708_100017962
207 Ga0070708_100493763
208 Ga0070681_10401151
209 Ga0068867_100765985
210 Ga0070707_101385644
211 Ga0070698_101235620
212 Ga0070695_100088837
213 Ga0070695_100434080
214 Ga0070693_100370774
215 Ga0070665_101138788
216 Ga0068861_100346878
217 Ga0068860_100006205
218 Ga0075365_10436455
219 Ga0075363_100065362
220 Ga0075364_10314294
221 Ga0075362_10208350
222 Ga0075367_10175192
223 Ga0075367_10315621
224 Ga0075367_10391455
225 Ga0097621_100277037
226 Ga0075370_10214457
227 Ga0075428_102257372
228 Ga0111539_10242892
229 Ga0105245_10022572
230 Ga0105245_10023564
231 Ga0105245_10272687
232 Ga0105245_10604515
233 Ga0114129_12827613
234 Ga0105243_10569158
235 Ga0105241_10042483
236 Ga0105237_10665766
237 Ga0105249_10720762
238 Ga0105249_10737055
239 Ga0105249_11122295
240 Ga0157371_10505970
241 Ga0157374_10653016
242 Ga0157378_10115778
243 Ga0157378_10217631
244 Ga0157378_10228500
245 Ga0157375_11013136
246 Ga0157377_10408145
247 Ga0157379_10973603
248 Ga0157379_11349216
249 Ga0163161_10454160
250 Ga0207705_11166389
251 Ga0207654_10286392
252 Ga0207707_10149090
253 Ga0207707_10594728
254 Ga0207663_10348028
255 Ga0207652_11786930
256 Ga0207646_10791242
257 Ga0207687_10021549
258 Ga0207706_10693713
259 Ga0207670_10392603
260 Ga0207711_10562154
261 Ga0207661_11055807
262 Ga0207712_10560597
263 Ga0207678_10900180
264 Ga0207708_10101782
265 Ga0207648_10159947
266 Ga0207675_100113351
267 Ga0207675_100541751
268 Ga0207675_101480301
269 Ga0207428_11234964
270 Ga0268264_10038286
271 Ga0265325_10217311
272 Ga0265327_10003642
273 Ga0265327_10219790
274 Ga0316579_10046460
275 Ga0265342_10138383
276 Ga0316576_10001293
277 Ga0316578_10031602
278 Ga0316577_10000860
279 Ga0307406_10182197
280 Ga0307407_10211043
281 Ga0307409_100017516
282 Ga0307411_10215393
283 Ga0307415_100051287
284 Ga0307415_101060530
285 Ga0316585_10034877
286 Ga0373941_0159780
287 Ga0373943_0045187
288 Ga0373946_0155503
289 Ga0316574_0002541
290 Ga0316574_0129409
291 Ga0316574_0214872
292 Ga0373935_0150258
293 Ga0373927_0044813
294 Ga0373947_0244874
295 Ga0373937_0190693
296 Ga0316582_0059075
297 Ga0316584_0000507
298 Ga0316584_0072756
299 Ga0316584_0164507
300 Ga0400483_045014
301 Ga0436365_0354478
302 Ga0436365_1205939
303 Ga0436365_1308611
304 Ga0436365_1723786
305 Ga0436360_0030020
306 Ga0436360_0191392
307 Ga0436360_0353664
308 Ga0436362_0426280
309 Ga0436362_1082493
310 Ga0436362_1184616
311 Ga0439465_0203427
312 Ga0451791_1577216
313 Ga0451835_0200535
314 Ga0439446_0093291
315 Ga0451577_0001387
316 Ga0453684_0003331
317 Ga0466960_0172873
318 Ga0466967_1083303
319 Ga0495629_0162976
320 Ga0495629_0263868
321 Ga0495582_0418290
322 Ga0495630_0132509
323 Ga0495630_0209185
324 Ga0495666_0194377
325 Ga0495665_0143785
326 Ga0495640_0111478
327 Ga0495621_0055107
328 Ga0495634_0177609
329 Ga0495588_0452772
330 Ga0495658_0208881
331 Ga0495613_0000685
332 Ga0495613_0304678
333 Ga0495624_0237717
334 Ga0495674_0273633
335 Ga0495676_0338160
336 Ga0495676_0639842
337 Ga0495680_0121145
338 Ga0495680_0305630
339 Ga0495680_0460514
340 Ga0495680_0537906
341 Ga0495684_0113444
342 Ga0495593_0327953
343 Ga0496100_1108970
344 Ga0496102_0325835
345 Ga0496105_0096994
346 Ga0496108_0113522
347 Ga0496108_0358891
348 Ga0496109_0004708
349 Ga0496109_1770413
350 Ga0496110_0004705
351 Ga0496110_0235224
352 Ga0496111_0260365
353 Ga0496112_0003736
354 Ga0496112_0110476
355 Ga0496114_0083554
356 Ga0496114_0262290
357 Ga0501033_0000587
358 Ga0501038_0391253
359 Ga0501040_0048900
360 Ga0501069_0083587
361 Ga0501069_0483322
362 Ga0501071_0082096
363 Ga0501072_0001973
364 Ga0501072_0100115
365 Ga0501072_0269405
366 Ga0501073_0131497
367 Ga0501074_0328645
368 Ga0501076_0113805
369 Ga0501080_0181034
370 Ga0501080_0587743
371 Ga0501044_0003952
372 Ga0501045_0082699
373 nmdc:mga03683_195213_c1
374 nmdc:mga00v17_1356_c1
375 nmdc:mga0yw44_111212_c2
376 nmdc:mga06z11_142508_c1
377 nmdc:mga06z11_196332_c1
378 nmdc:mga06z11_43820_c2
379 nmdc:mga04h51_187316_c1
380 nmdc:mga07m45_243587_c1
381 nmdc:mga05p37_1858050_c1
382 nmdc:mga08y16_94273_c1
383 nmdc:mga0n895_288296_c1
384 nmdc:mga0n895_55236_c1
385 Ga0500646_0087860
386 Ga0500641_0015415
387 Ga0500604_0077162
388 Ga0501084_0000009
389 Ga0501084_0969790
390 Ga0587115_075975
391 Ga0587069_048426
392 Ga0501082_0027672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13187

Fer4_9

4Fe-4S dicluster domain

68

133

0.94

PF00037

Fer4

4Fe-4S binding domain

111

134

0.93

PF12838

Fer4_7

4Fe-4S dicluster domain

42

132

0.84

PF13237

Fer4_10

4Fe-4S dicluster domain

62

129

0.83

Map