F301764

General Info

Members Datasets Scaffolds Average Seq Length
196 136 195 82

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10598559|Ga0307513_105985592
Length 96
Sequence MNYPLQRFTIQYRSIMHLEILTPEKKVFEGDVTIATFPGSDGSFQVMDHHAPLISLLKEGVVEYKGKEGARSVTITGGVVEVLKNKTILLADGVIE

Samples

Sample ID Description Type Environment
1 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
81 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
82 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
85 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
99 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
100 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
101 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
108 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
109 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
110 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
111 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
112 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
113 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
114 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
115 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
116 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
119 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
120 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
128 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
129 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
134 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 4.59
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 0
Rhizoplane 3.06
Rhizosphere 67.86
Stem 0
Stem Tuber 0
Unclassified 15.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10035249 3300003316 Bacteria 45273
2 rootH1_10118910 3300003316 Bacteria 1698
3 rootH2_10011821 3300003320 Bacteria 27973
4 rootH2_10094191 3300003320 Bacteria 1310
5 rootL2_10026901 3300003322 Bacteria 4268
6 rootL2_10042897 3300003322 Bacteria 2719
7 rootL2_10042898 3300003322 Bacteria 3000
8 rootL2_10088882 3300003322 Bacteria 5076
9 rootL2_10139812 3300003322 Bacteria 1545
10 rootH1_10006645 3300003323 Bacteria 138273
11 rootH1_10006646 3300003323 Bacteria 14450
12 rootH1_10010049 3300003323 Bacteria 56441
13 rootH1_10053750 3300003323 Bacteria 1295
14 rootH1_10104486 3300003323 Bacteria 5486
15 rootH1_10181515 3300003323 Bacteria 2710
16 Ga0055531_10000464 3300003794 Bacteria 37500
17 Ga0065165_1000546 3300005262 Bacteria 56702
18 Ga0070658_11800474 3300005327 Bacteria 530
19 Ga0070676_10000829 3300005328 Bacteria 15285
20 Ga0070677_10060017 3300005333 Bacteria 1566
21 Ga0070680_101925539 3300005336 Bacteria 512
22 Ga0070682_100674021 3300005337 Bacteria 826
23 Ga0070682_101148538 3300005337 Unclassified 653
24 Ga0070682_101216974 3300005337 Bacteria 636
25 Ga0070671_100000489 3300005355 Bacteria 27650
26 Ga0070671_100420910 3300005355 Bacteria 1144
27 Ga0070667_100635178 3300005367 Bacteria 985
28 Ga0068853_100389923 3300005539 Bacteria 1302
29 Ga0070665_101775082 3300005548 Bacteria 624
30 Ga0068855_100634555 3300005563 Bacteria 1149
31 Ga0068857_100469511 3300005577 Bacteria 1178
32 Ga0068857_101313619 3300005577 Bacteria 702
33 Ga0068856_100078964 3300005614 Bacteria 3263
34 Ga0068856_101955580 3300005614 Unclassified 597
35 Ga0068852_102661226 3300005616 Bacteria 520
36 Ga0068859_100364016 3300005617 Bacteria 1541
37 Ga0068859_101863416 3300005617 Unclassified 664
38 Ga0068864_100430877 3300005618 Bacteria 1258
39 Ga0068864_101521454 3300005618 Bacteria 672
40 Ga0068863_100183626 3300005841 Bacteria 2008
41 Ga0068863_102540237 3300005841 Bacteria 521
42 Ga0070717_10254465 3300006028 Bacteria 1552
43 Ga0070715_10652860 3300006163 Bacteria 623
44 Ga0097621_101345908 3300006237 Bacteria 675
45 Ga0097621_101791708 3300006237 Bacteria 585
46 Ga0068871_101625505 3300006358 Bacteria 612
47 Ga0075428_100029533 3300006844 Bacteria 6065
48 Ga0075428_100446915 3300006844 Bacteria 1385
49 Ga0075431_100804144 3300006847 Bacteria 913
50 Ga0075429_101029725 3300006880 Bacteria 719
51 Ga0097620_100363991 3300006931 Bacteria 1541
52 Ga0097620_101863831 3300006931 Unclassified 664
53 Ga0111539_10000601 3300009094 Bacteria 46564
54 Ga0111539_10009322 3300009094 Bacteria 12398
55 Ga0111539_13423500 3300009094 Bacteria 510
56 Ga0105243_13109586 3300009148 Unclassified 502
57 Ga0105237_10133005 3300009545 Bacteria 2482
58 Ga0157378_10435163 3300013297 Bacteria 1299
59 Ga0163162_11322074 3300013306 Bacteria 819
60 Ga0157375_10035405 3300013308 Bacteria 4765
61 Ga0163163_11370134 3300014325 Bacteria 769
62 Ga0157380_10001271 3300014326 Bacteria 16392
63 Ga0157380_10624848 3300014326 Bacteria 1070
64 Ga0157380_11892055 3300014326 Bacteria 657
65 Ga0157380_12743216 3300014326 Bacteria 559
66 Ga0157379_10398790 3300014968 Bacteria 1264
67 Ga0157376_11112730 3300014969 Bacteria 816
68 Ga0209455_1029798 3300025272 Bacteria 937
69 Ga0209050_1004433 3300025298 Bacteria 9490
70 Ga0209257_1000007 3300025304 Bacteria 1564415
71 Ga0209257_1073595 3300025304 Bacteria 894
72 Ga0207695_11094767 3300025913 Bacteria 676
73 Ga0207671_11151379 3300025914 Bacteria 608
74 Ga0207660_11580016 3300025917 Bacteria 529
75 Ga0207694_10263432 3300025924 Bacteria 1412
76 Ga0207665_10933481 3300025939 Bacteria 689
77 Ga0207658_11212977 3300025986 Unclassified 690
78 Ga0207639_10381201 3300026041 Bacteria 1266
79 Ga0207702_10139492 3300026078 Bacteria 2192
80 Ga0207702_11430556 3300026078 Unclassified 685
81 Ga0207641_10163707 3300026088 Bacteria 2024
82 Ga0207676_10416256 3300026095 Bacteria 1259
83 Ga0207674_10899488 3300026116 Bacteria 853
84 Ga0207674_11203892 3300026116 Bacteria 727
85 Ga0209974_10233841 3300027876 Unclassified 688
86 Ga0207428_10381837 3300027907 Bacteria 1033
87 Ga0207428_10847308 3300027907 Unclassified 648
88 Ga0268266_10297930 3300028379 Bacteria 1504
89 Ga0307517_10639573 3300028786 Bacteria 519
90 Ga0307515_10052555 3300028794 Bacteria 6040
91 Ga0307515_10089317 3300028794 Bacteria 3881
92 Ga0307515_10134119 3300028794 Bacteria 2705
93 Ga0265327_10213413 3300031251 Bacteria 870
94 Ga0307513_10126513 3300031456 Bacteria 2510
95 Ga0307513_10147830 3300031456 Bacteria 2265
96 Ga0307513_10294295 3300031456 Bacteria 1393
97 Ga0307513_10443435 3300031456 Bacteria 1024
98 Ga0307513_10598559 3300031456 Bacteria 812
99 Ga0307509_10083892 3300031507 Bacteria 3283
100 Ga0307509_10291594 3300031507 Bacteria 1386
101 Ga0307408_100006855 3300031548 Bacteria 7552
102 Ga0307408_100371940 3300031548 Bacteria 1219
103 Ga0307408_100499076 3300031548 Unclassified 1065
104 Ga0307405_10048995 3300031731 Bacteria 2609
105 Ga0307413_10162846 3300031824 Bacteria 1569
106 Ga0307413_10165553 3300031824 Bacteria 1559
107 Ga0307413_11065291 3300031824 Bacteria 696
108 Ga0307410_10518571 3300031852 Bacteria 983
109 Ga0307412_10022545 3300031911 Bacteria 3862
110 Ga0307409_101829634 3300031995 Bacteria 636
111 Ga0307416_100002495 3300032002 Bacteria 10585
112 Ga0307416_103150997 3300032002 Bacteria 552
113 Ga0307416_103802342 3300032002 Unclassified 505
114 Ga0307411_10313062 3300032005 Bacteria 1264
115 Ga0307415_100003616 3300032126 Bacteria 7899
116 Ga0373950_0005606 3300034818 Unclassified 1882
117 Ga0373931_0068121 3300035691 Bacteria 1936
118 Ga0373937_0806329 3300036401 Bacteria 887
119 Ga0439447_069626 3300041407 Unclassified 819
120 Ga0451791_1569185 3300041451 Bacteria 830
121 Ga0451797_1046003 3300041453 Bacteria 644
122 Ga0451807_0807353 3300041486 Bacteria 522
123 Ga0451807_1642373 3300041486 Bacteria 547
124 Ga0451839_0009395 3300041496 Bacteria 543
125 Ga0451841_0520070 3300041498 Bacteria 607
126 Ga0451851_1317949 3300041507 Unclassified 657
127 Ga0451853_2738418 3300041512 Bacteria 605
128 Ga0439433_0143268 3300041999 Unclassified 612
129 Ga0439442_160106 3300042002 Unclassified 503
130 Ga0451577_0543407 3300042876 Bacteria 1055
131 Ga0451576_0129819 3300045051 Bacteria 2626
132 Ga0495592_0181743 3300046454 Bacteria 1432
133 Ga0495638_0000040 3300046460 Bacteria 241883
134 Ga0495628_0982394 3300046516 Bacteria 582
135 Ga0495657_0312155 3300046675 Unclassified 936
136 Ga0495604_0237501 3300047317 Bacteria 1248
137 Ga0495675_0535000 3300047444 Bacteria 670
138 Ga0496104_0078130 3300048907 Bacteria 3154
139 Ga0496114_0289937 3300048917 Bacteria 1444
140 Ga0501310_004635 3300049130 Bacteria 1386
141 Ga0501305_002912 3300049161 Bacteria 1893
142 Ga0501290_056905 3300049513 Bacteria 621
143 Ga0501296_043511 3300049519 Bacteria 640
144 Ga0501298_145732 3300049521 Bacteria 576
145 Ga0501311_102990 3300049527 Bacteria 507
146 Ga0501312_009057 3300049528 Bacteria 1305
147 Ga0501313_025514 3300049529 Bacteria 748
148 Ga0501315_002155 3300049531 Bacteria 1813
149 Ga0501315_005854 3300049531 Bacteria 1347
150 Ga0501315_017176 3300049531 Bacteria 943
151 Ga0501335_040559 3300049551 Bacteria 548
152 Ga0501034_1349142 3300049571 Unclassified 589
153 Ga0501201_025897 3300049651 Bacteria 645
154 Ga0501202_002804 3300049652 Bacteria 2953
155 Ga0501202_008705 3300049652 Bacteria 1854
156 Ga0501217_143124 3300049661 Unclassified 709
157 Ga0501235_088410 3300049669 Bacteria 746
158 Ga0501236_002736 3300049670 Bacteria 2030
159 Ga0501236_120952 3300049670 Bacteria 532
160 Ga0501242_003897 3300049674 Bacteria 1636
161 Ga0501253_102424 3300049683 Unclassified 673
162 Ga0501253_128261 3300049683 Bacteria 621
163 Ga0501257_005339 3300049686 Bacteria 2828
164 Ga0501257_005992 3300049686 Bacteria 2692
165 Ga0501257_011702 3300049686 Bacteria 2005
166 Ga0501257_261133 3300049686 Unclassified 516
167 Ga0501259_020061 3300049688 Bacteria 1182
168 Ga0501261_023470 3300049690 Bacteria 898
169 Ga0501225_0007936 3300049705 Bacteria 3060
170 Ga0501234_072890 3300049707 Bacteria 596
171 Ga0501271_014169 3300049768 Bacteria 880
172 Ga0501200_04870 3300049849 Bacteria 626
173 nmdc:mga0k408_524676_c1 3300050493 Bacteria 701
174 nmdc:mga06r32_720083_c1 3300050510 Bacteria 962
175 nmdc:mga08y16_14621_c1 3300050511 Bacteria 8255
176 nmdc:mga08y16_335052_c1 3300050511 Bacteria 1556
177 Ga0500646_0317490 3300053090 Bacteria 562
178 Ga0500583_0140310 3300053092 Bacteria 1201
179 Ga0500651_0139422 3300053093 Bacteria 1462
180 Ga0500650_0150522 3300053098 Bacteria 1076
181 Ga0500556_0025211 3300053104 Bacteria 1963
182 Ga0500557_167585 3300053105 Bacteria 718
183 Ga0500562_005341 3300053108 Bacteria 3226
184 Ga0500642_0028599 3300053130 Bacteria 2301
185 Ga0500652_182926 3300053131 Bacteria 858
186 Ga0500577_0317269 3300053142 Bacteria 681
187 Ga0500604_0000716 3300053151 Bacteria 9075
188 Ga0500604_0356814 3300053151 Bacteria 508
189 Ga0500616_0000013 3300053153 Bacteria 674172
190 Ga0500616_0019315 3300053153 Bacteria 3844
191 Ga0500616_0080720 3300053153 Bacteria 1635
192 Ga0500622_0000009 3300053156 Bacteria 419980
193 Ga0500622_0000016 3300053156 Bacteria 337983
194 Ga0500622_0009337 3300053156 Bacteria 5431
195 Ga0500622_0439039 3300053156 Bacteria 522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2839989709 2839989791 77
2 3300003322 rootL2_10042897 rootL2_100428975 80
3 3300005614 Ga0068856_101955580 Ga0068856_1019555802 80
4 3300025272 Ga0209455_1029798 Ga0209455_10297982 80
5 3300025913 Ga0207695_11094767 Ga0207695_110947672 80
6 3300026078 Ga0207702_11430556 Ga0207702_114305562 80
7 3300031548 Ga0307408_100371940 Ga0307408_1003719402 80
8 3300031731 Ga0307405_10048995 Ga0307405_100489955 80
9 3300031824 Ga0307413_10162846 Ga0307413_101628461 80
10 3300031852 Ga0307410_10518571 Ga0307410_105185712 80
11 3300031911 Ga0307412_10022545 Ga0307412_100225453 80
12 3300031995 Ga0307409_101829634 Ga0307409_1018296342 80
13 3300032002 Ga0307416_100002495 Ga0307416_1000024958 80
14 3300032005 Ga0307411_10313062 Ga0307411_103130622 80
15 3300032126 Ga0307415_100003616 Ga0307415_1000036166 80
16 3300041486 Ga0451807_0807353 Ga0451807_0807353_213_458 80
17 3300041498 Ga0451841_0520070 Ga0451841_0520070_15_290 80
18 3300041507 Ga0451851_1317949 Ga0451851_1317949_397_639 80
19 3300041999 Ga0439433_0143268 Ga0439433_0143268_129_374 80
20 3300049669 Ga0501235_088410 Ga0501235_088410_246_488 80
21 3300049707 Ga0501234_072890 Ga0501234_072890_13_255 80
22 3300003316 rootH1_10035249 rootH1_1003524936 81
23 3300003316 rootH1_10118910 rootH1_101189102 81
24 3300003320 rootH2_10011821 rootH2_1001182123 81
25 3300003320 rootH2_10094191 rootH2_100941912 81
26 3300003322 rootL2_10026901 rootL2_100269012 81
27 3300003322 rootL2_10042898 rootL2_100428985 81
28 3300003322 rootL2_10088882 rootL2_100888822 81
29 3300003322 rootL2_10139812 rootL2_101398123 81
30 3300003323 rootH1_10006645 rootH1_10006645112 81
31 3300003323 rootH1_10006646 rootH1_1000664614 81
32 3300003323 rootH1_10010049 rootH1_1001004943 81
33 3300003323 rootH1_10053750 rootH1_100537502 81
34 3300003323 rootH1_10104486 rootH1_101044861 81
35 3300003323 rootH1_10181515 rootH1_101815155 81
36 3300003794 Ga0055531_10000464 Ga0055531_100004647 81
37 3300005262 Ga0065165_1000546 Ga0065165_100054643 81
38 3300005327 Ga0070658_11800474 Ga0070658_118004742 81
39 3300005328 Ga0070676_10000829 Ga0070676_1000082914 81
40 3300005333 Ga0070677_10060017 Ga0070677_100600174 81
41 3300005336 Ga0070680_101925539 Ga0070680_1019255391 81
42 3300005337 Ga0070682_100674021 Ga0070682_1006740211 81
43 3300005337 Ga0070682_101148538 Ga0070682_1011485381 81
44 3300005337 Ga0070682_101216974 Ga0070682_1012169742 81
45 3300005355 Ga0070671_100000489 Ga0070671_10000048928 81
46 3300005355 Ga0070671_100420910 Ga0070671_1004209101 81
47 3300005367 Ga0070667_100635178 Ga0070667_1006351781 81
48 3300005539 Ga0068853_100389923 Ga0068853_1003899232 81
49 3300005548 Ga0070665_101775082 Ga0070665_1017750822 81
50 3300005563 Ga0068855_100634555 Ga0068855_1006345552 81
51 3300005577 Ga0068857_100469511 Ga0068857_1004695112 81
52 3300005577 Ga0068857_101313619 Ga0068857_1013136192 81
53 3300005614 Ga0068856_100078964 Ga0068856_1000789645 81
54 3300005616 Ga0068852_102661226 Ga0068852_1026612261 81
55 3300005617 Ga0068859_100364016 Ga0068859_1003640162 81
56 3300005617 Ga0068859_101863416 Ga0068859_1018634162 81
57 3300005618 Ga0068864_100430877 Ga0068864_1004308772 81
58 3300005618 Ga0068864_101521454 Ga0068864_1015214542 81
59 3300005841 Ga0068863_100183626 Ga0068863_1001836261 81
60 3300005841 Ga0068863_102540237 Ga0068863_1025402371 81
61 3300006028 Ga0070717_10254465 Ga0070717_102544651 81
62 3300006163 Ga0070715_10652860 Ga0070715_106528601 81
63 3300006237 Ga0097621_101345908 Ga0097621_1013459081 81
64 3300006237 Ga0097621_101791708 Ga0097621_1017917081 81
65 3300006358 Ga0068871_101625505 Ga0068871_1016255052 81
66 3300006844 Ga0075428_100029533 Ga0075428_1000295332 81
67 3300006844 Ga0075428_100446915 Ga0075428_1004469152 81
68 3300006847 Ga0075431_100804144 Ga0075431_1008041442 81
69 3300006880 Ga0075429_101029725 Ga0075429_1010297252 81
70 3300006931 Ga0097620_100363991 Ga0097620_1003639913 81
71 3300006931 Ga0097620_101863831 Ga0097620_1018638311 81
72 3300009094 Ga0111539_10000601 Ga0111539_1000060135 81
73 3300009094 Ga0111539_10009322 Ga0111539_100093229 81
74 3300009094 Ga0111539_13423500 Ga0111539_134235002 81
75 3300009148 Ga0105243_13109586 Ga0105243_131095861 81
76 3300009545 Ga0105237_10133005 Ga0105237_101330055 81
77 3300013297 Ga0157378_10435163 Ga0157378_104351631 81
78 3300013306 Ga0163162_11322074 Ga0163162_113220742 81
79 3300013308 Ga0157375_10035405 Ga0157375_100354057 81
80 3300014325 Ga0163163_11370134 Ga0163163_113701342 81
81 3300014326 Ga0157380_10001271 Ga0157380_1000127112 81
82 3300014326 Ga0157380_10624848 Ga0157380_106248482 81
83 3300014326 Ga0157380_11892055 Ga0157380_118920552 81
84 3300014326 Ga0157380_12743216 Ga0157380_127432161 81
85 3300014968 Ga0157379_10398790 Ga0157379_103987902 81
86 3300014969 Ga0157376_11112730 Ga0157376_111127302 81
87 3300025298 Ga0209050_1004433 Ga0209050_10044338 81
88 3300025304 Ga0209257_1000007 Ga0209257_1000007381 81
89 3300025304 Ga0209257_1073595 Ga0209257_10735952 81
90 3300025914 Ga0207671_11151379 Ga0207671_111513791 81
91 3300025917 Ga0207660_11580016 Ga0207660_115800161 81
92 3300025924 Ga0207694_10263432 Ga0207694_102634322 81
93 3300025939 Ga0207665_10933481 Ga0207665_109334812 81
94 3300025986 Ga0207658_11212977 Ga0207658_112129771 81
95 3300026041 Ga0207639_10381201 Ga0207639_103812012 81
96 3300026078 Ga0207702_10139492 Ga0207702_101394922 81
97 3300026088 Ga0207641_10163707 Ga0207641_101637072 81
98 3300026095 Ga0207676_10416256 Ga0207676_104162562 81
99 3300026116 Ga0207674_10899488 Ga0207674_108994882 81
100 3300026116 Ga0207674_11203892 Ga0207674_112038921 81
101 3300027876 Ga0209974_10233841 Ga0209974_102338412 81
102 3300027907 Ga0207428_10381837 Ga0207428_103818371 81
103 3300027907 Ga0207428_10847308 Ga0207428_108473082 81
104 3300028379 Ga0268266_10297930 Ga0268266_102979302 81
105 3300028786 Ga0307517_10639573 Ga0307517_106395732 81
106 3300028794 Ga0307515_10052555 Ga0307515_100525553 81
107 3300028794 Ga0307515_10089317 Ga0307515_100893173 81
108 3300028794 Ga0307515_10134119 Ga0307515_101341193 81
109 3300031251 Ga0265327_10213413 Ga0265327_102134131 81
110 3300031456 Ga0307513_10126513 Ga0307513_101265132 81
111 3300031456 Ga0307513_10147830 Ga0307513_101478303 81
112 3300031456 Ga0307513_10294295 Ga0307513_102942953 81
113 3300031456 Ga0307513_10443435 Ga0307513_104434352 81
114 3300031456 Ga0307513_10598559 Ga0307513_105985592 81
115 3300031507 Ga0307509_10083892 Ga0307509_100838922 81
116 3300031507 Ga0307509_10291594 Ga0307509_102915941 81
117 3300031548 Ga0307408_100006855 Ga0307408_1000068555 81
118 3300031548 Ga0307408_100499076 Ga0307408_1004990763 81
119 3300031824 Ga0307413_10165553 Ga0307413_101655532 81
120 3300031824 Ga0307413_11065291 Ga0307413_110652912 81
121 3300032002 Ga0307416_103150997 Ga0307416_1031509971 81
122 3300032002 Ga0307416_103802342 Ga0307416_1038023421 81
123 3300034818 Ga0373950_0005606 Ga0373950_0005606_187_441 81
124 3300035691 Ga0373931_0068121 Ga0373931_0068121_281_535 81
125 3300036401 Ga0373937_0806329 Ga0373937_0806329_546_797 81
126 3300041407 Ga0439447_069626 Ga0439447_069626_19_264 81
127 3300041451 Ga0451791_1569185 Ga0451791_1569185_466_711 81
128 3300041453 Ga0451797_1046003 Ga0451797_1046003_240_485 81
129 3300041486 Ga0451807_1642373 Ga0451807_1642373_288_533 81
130 3300041496 Ga0451839_0009395 Ga0451839_0009395_130_375 81
131 3300041512 Ga0451853_2738418 Ga0451853_2738418_70_315 81
132 3300042002 Ga0439442_160106 Ga0439442_160106_60_305 81
133 3300042876 Ga0451577_0543407 Ga0451577_0543407_234_482 81
134 3300045051 Ga0451576_0129819 Ga0451576_0129819_1416_1661 81
135 3300046454 Ga0495592_0181743 Ga0495592_0181743_141_386 81
136 3300046460 Ga0495638_0000040 Ga0495638_0000040_184233_184478 81
137 3300046516 Ga0495628_0982394 Ga0495628_0982394_245_490 81
138 3300046675 Ga0495657_0312155 Ga0495657_0312155_119_370 81
139 3300047317 Ga0495604_0237501 Ga0495604_0237501_604_849 81
140 3300047444 Ga0495675_0535000 Ga0495675_0535000_101_346 81
141 3300048907 Ga0496104_0078130 Ga0496104_0078130_972_1229 81
142 3300048917 Ga0496114_0289937 Ga0496114_0289937_1137_1394 81
143 3300049130 Ga0501310_004635 Ga0501310_004635_29_274 81
144 3300049161 Ga0501305_002912 Ga0501305_002912_1623_1868 81
145 3300049513 Ga0501290_056905 Ga0501290_056905_108_353 81
146 3300049519 Ga0501296_043511 Ga0501296_043511_365_613 81
147 3300049521 Ga0501298_145732 Ga0501298_145732_289_540 81
148 3300049527 Ga0501311_102990 Ga0501311_102990_15_263 81
149 3300049528 Ga0501312_009057 Ga0501312_009057_1036_1281 81
150 3300049529 Ga0501313_025514 Ga0501313_025514_476_721 81
151 3300049531 Ga0501315_002155 Ga0501315_002155_1542_1787 81
152 3300049531 Ga0501315_005854 Ga0501315_005854_11_256 81
153 3300049531 Ga0501315_017176 Ga0501315_017176_10_255 81
154 3300049551 Ga0501335_040559 Ga0501335_040559_160_405 81
155 3300049571 Ga0501034_1349142 Ga0501034_1349142_10_255 81
156 3300049651 Ga0501201_025897 Ga0501201_025897_326_604 81
157 3300049652 Ga0501202_002804 Ga0501202_002804_1334_1579 81
158 3300049652 Ga0501202_008705 Ga0501202_008705_264_509 81
159 3300049661 Ga0501217_143124 Ga0501217_143124_160_405 81
160 3300049670 Ga0501236_002736 Ga0501236_002736_1699_1944 81
161 3300049670 Ga0501236_120952 Ga0501236_120952_182_427 81
162 3300049674 Ga0501242_003897 Ga0501242_003897_48_293 81
163 3300049683 Ga0501253_102424 Ga0501253_102424_379_624 81
164 3300049683 Ga0501253_128261 Ga0501253_128261_335_580 81
165 3300049686 Ga0501257_005339 Ga0501257_005339_843_1088 81
166 3300049686 Ga0501257_005992 Ga0501257_005992_752_997 81
167 3300049686 Ga0501257_011702 Ga0501257_011702_1268_1516 81
168 3300049686 Ga0501257_261133 Ga0501257_261133_121_375 81
169 3300049688 Ga0501259_020061 Ga0501259_020061_102_347 81
170 3300049690 Ga0501261_023470 Ga0501261_023470_307_561 81
171 3300049705 Ga0501225_0007936 Ga0501225_0007936_2597_2842 81
172 3300049768 Ga0501271_014169 Ga0501271_014169_87_332 81
173 3300049849 Ga0501200_04870 Ga0501200_04870_343_588 81
174 3300050493 nmdc:mga0k408_524676_c1 nmdc:mga0k408_524676_c1_385_630 81
175 3300050510 nmdc:mga06r32_720083_c1 nmdc:mga06r32_720083_c1_497_742 81
176 3300050511 nmdc:mga08y16_14621_c1 nmdc:mga08y16_14621_c1_5585_5830 81
177 3300050511 nmdc:mga08y16_335052_c1 nmdc:mga08y16_335052_c1_530_775 81
178 3300053090 Ga0500646_0317490 Ga0500646_0317490_278_526 81
179 3300053092 Ga0500583_0140310 Ga0500583_0140310_542_787 81
180 3300053093 Ga0500651_0139422 Ga0500651_0139422_1071_1316 81
181 3300053098 Ga0500650_0150522 Ga0500650_0150522_435_686 81
182 3300053104 Ga0500556_0025211 Ga0500556_0025211_1421_1666 81
183 3300053105 Ga0500557_167585 Ga0500557_167585_121_366 81
184 3300053108 Ga0500562_005341 Ga0500562_005341_1915_2160 81
185 3300053130 Ga0500642_0028599 Ga0500642_0028599_344_589 81
186 3300053131 Ga0500652_182926 Ga0500652_182926_214_459 81
187 3300053142 Ga0500577_0317269 Ga0500577_0317269_216_461 81
188 3300053151 Ga0500604_0000716 Ga0500604_0000716_8017_8262 81
189 3300053151 Ga0500604_0356814 Ga0500604_0356814_175_420 81
190 3300053153 Ga0500616_0000013 Ga0500616_0000013_129928_130173 81
191 3300053153 Ga0500616_0019315 Ga0500616_0019315_922_1170 81
192 3300053153 Ga0500616_0080720 Ga0500616_0080720_366_611 81
193 3300053156 Ga0500622_0000009 Ga0500622_0000009_251482_251727 81
194 3300053156 Ga0500622_0000016 Ga0500622_0000016_256618_256863 81
195 3300053156 Ga0500622_0009337 Ga0500622_0009337_230_475 81
196 3300053156 Ga0500622_0439039 Ga0500622_0439039_45_290 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

16

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oaa-assembly4.cif.gz_f structure of the e.coli f1-atp synthase inhibited by subunit epsilon 0.9705 2 77
1fs0-assembly1.cif.gz_E complex of gamma/epsilon atp synthase from e.coli 0.958 2 77
8dbs-assembly1.cif.gz_H "e. coli atp synthase imaged in 10mm mgatp state2 ""half-up"" fo classified" 0.9546 2 78
6fkh-assembly1.cif.gz_e chloroplast f1fo conformation 2 0.9505 1 79
6ree-assembly1.cif.gz_R cryo-em structure of polytomella f-atp synthase, rotary substate 3b, composite map 0.947 2 81
ID Description Score Start End Superfamily
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9756 1 80 2.60.15.10
af_Q55F42_29_165_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9726 3 80 2.60.15.10
af_Q9P6R6_26_125_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9671 2 80 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9601 22 80 2.60.15.10
af_Q12165_23_119_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.959 1 80 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A1K1NFH8-F1-model_v4 F-type H+-transporting ATPase subunit epsilon 0.9982 1 77 GO:0012505
GO:0045261
GO:0046933
AF-R5FMX7-F1-model_v4 ATP synthase Delta/Epsilon chain beta-sandwich domain protein 0.9971 2 77 GO:0012505
GO:0045261
GO:0046933
AF-A0A1W2GYV4-F1-model_v4 F-type H+-transporting ATPase subunit epsilon 0.9957 1 81 GO:0012505
GO:0045261
GO:0046933
AF-A0A1V5F5G3-F1-model_v4 ATP synthase epsilon chain 0.9948 1 79 GO:0012505
GO:0045261
GO:0046933
AF-A0A3D4ZC69-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9943 1 77 GO:0012505
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
95.58 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map