F301684

General Info

Members Datasets Scaffolds Average Seq Length
196 136 392 405

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10231330|Ga0207665_102313301
Length 426
Sequence MNQSNIVILGGGMVAGYAAKQLVELGLPKGELAILSADNAVPYERPPLSKGFLAGKDSEDAIRINPEDFYRKQGIELRLNCEVASVDLKRKRLILKGGDEFGFQKLVIATGARPRTLDVPGSKLQNLFYLRSMSDSQTIRSAAEKAKHAVVIGGGFIGMEVAAVLAQKGIEVAMVLHDDRVFKRLFSPEMSSFFENYYAARGVRLAKSMSVTEFRGDGAIKSSVLRDGQSIQCDLVIAGIGVSPVIDLLKNGGLDLDDGILVNEYLQSSHPDVFAAGDVANYNDVLFGKRRRVEHWDNAVSQGQYCAKVLRGDKAPFRHVPYFFSDVFDLSYEYWGDSSGADQVVHRGDLSSNSFSVWWVHQQRLVAAFAMNRPDEERNLAPKWIESGQRVSVAKLKDASQPIEETEALREQLESANARLKLAAGK

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 15.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10231330 3300025939 Bacteria 1359
2 Ga0070683_100019107 3300005329 Bacteria 6081
3 Ga0070670_100011333 3300005331 Bacteria 7619
4 Ga0070680_100058257 3300005336 Unclassified 3159
5 Ga0070680_100059790 3300005336 Bacteria 3119
6 Ga0068868_100063511 3300005338 Bacteria 2929
7 Ga0070687_100045781 3300005343 Bacteria 2236
8 Ga0070675_100281961 3300005354 Bacteria 1460
9 Ga0070674_100201182 3300005356 Bacteria 1538
10 Ga0070674_100213459 3300005356 Unclassified 1497
11 Ga0070709_10032769 3300005434 Bacteria 3136
12 Ga0070709_10050474 3300005434 Bacteria 2606
13 Ga0070714_100060401 3300005435 Bacteria 3253
14 Ga0070713_100033872 3300005436 Bacteria 4097
15 Ga0070713_100133443 3300005436 Unclassified 2192
16 Ga0070711_100049916 3300005439 Unclassified 2866
17 Ga0070705_100050775 3300005440 Bacteria 2414
18 Ga0070708_100008426 3300005445 Bacteria 8276
19 Ga0070708_100042680 3300005445 Unclassified 3983
20 Ga0070708_100273370 3300005445 Bacteria 1589
21 Ga0070681_10014814 3300005458 Bacteria 7755
22 Ga0070681_10086483 3300005458 Bacteria 3088
23 Ga0068867_100002053 3300005459 Bacteria 14099
24 Ga0070706_100043174 3300005467 Bacteria 4165
25 Ga0070706_100109442 3300005467 Bacteria 2571
26 Ga0070706_100168534 3300005467 Bacteria 2045
27 Ga0070707_100043971 3300005468 Bacteria 4275
28 Ga0070707_100078221 3300005468 Bacteria 3191
29 Ga0070698_100047684 3300005471 Bacteria 4379
30 Ga0070679_100052688 3300005530 Bacteria 4052
31 Ga0070679_100150885 3300005530 Bacteria 2301
32 Ga0070684_100052821 3300005535 Unclassified 3535
33 Ga0070684_100174343 3300005535 Bacteria 1954
34 Ga0068853_100031278 3300005539 Bacteria 4502
35 Ga0070665_100112514 3300005548 Bacteria 2725
36 Ga0070665_100146272 3300005548 Unclassified 2366
37 Ga0068855_100012373 3300005563 Bacteria 10308
38 Ga0068855_100019186 3300005563 Bacteria 8219
39 Ga0068855_100110523 3300005563 Bacteria 3155
40 Ga0068855_100530603 3300005563 Bacteria 1276
41 Ga0070664_100002287 3300005564 Bacteria 15405
42 Ga0068857_100003176 3300005577 Bacteria 13625
43 Ga0068857_100096093 3300005577 Bacteria 2655
44 Ga0068854_100001451 3300005578 Bacteria 14356
45 Ga0068856_100003086 3300005614 Bacteria 17013
46 Ga0068856_100182913 3300005614 Bacteria 2109
47 Ga0068852_100007789 3300005616 Bacteria 7842
48 Ga0068859_100003224 3300005617 Bacteria 16610
49 Ga0068863_100262391 3300005841 Bacteria 1670
50 Ga0068858_100002226 3300005842 Bacteria 19599
51 Ga0068860_100016394 3300005843 Bacteria 7224
52 Ga0081455_10026423 3300005937 Bacteria 5339
53 Ga0070717_10000519 3300006028 Bacteria 24455
54 Ga0070717_10013635 3300006028 Bacteria 6236
55 Ga0070717_10030256 3300006028 Bacteria 4349
56 Ga0070716_100096935 3300006173 Bacteria 1799
57 Ga0070712_100003144 3300006175 Bacteria 10172
58 Ga0070712_100031917 3300006175 Bacteria 3552
59 Ga0070712_100075471 3300006175 Bacteria 2424
60 Ga0068871_100027329 3300006358 Bacteria 4462
61 Ga0075430_100023162 3300006846 Bacteria 5282
62 Ga0075433_10061751 3300006852 Unclassified 3282
63 Ga0075434_100003557 3300006871 Bacteria 13913
64 Ga0075436_100013144 3300006914 Bacteria 5676
65 Ga0097620_100003224 3300006931 Bacteria 16610
66 Ga0105240_10001187 3300009093 Bacteria 45557
67 Ga0105240_10005709 3300009093 Bacteria 18464
68 Ga0105240_10007053 3300009093 Bacteria 16383
69 Ga0105240_10163265 3300009093 Bacteria 2644
70 Ga0105245_10008380 3300009098 Bacteria 9030
71 Ga0105245_10320452 3300009098 Bacteria 1527
72 Ga0105241_10014326 3300009174 Bacteria 5806
73 Ga0105242_10004847 3300009176 Bacteria 10419
74 Ga0105248_10120152 3300009177 Unclassified 2964
75 Ga0105248_10151316 3300009177 Bacteria 2618
76 Ga0105237_10001552 3300009545 Bacteria 29969
77 Ga0105249_10061740 3300009553 Bacteria 3439
78 Ga0105249_10096961 3300009553 Bacteria 2767
79 Ga0105246_10084978 3300011119 Bacteria 2265
80 Ga0157373_10020350 3300013100 Bacteria 4824
81 Ga0157370_10001003 3300013104 Bacteria 35617
82 Ga0157370_10001529 3300013104 Bacteria 28617
83 Ga0157369_10077860 3300013105 Bacteria 3553
84 Ga0157374_10000935 3300013296 Bacteria 25437
85 Ga0157378_10000416 3300013297 Bacteria 41949
86 Ga0163162_10048317 3300013306 Bacteria 4263
87 Ga0163162_10163809 3300013306 Unclassified 2347
88 Ga0157372_10108151 3300013307 Bacteria 3182
89 Ga0207642_10078791 3300025899 Bacteria 1593
90 Ga0207647_10016614 3300025904 Bacteria 5020
91 Ga0207654_10044528 3300025911 Bacteria 2521
92 Ga0207707_10011312 3300025912 Bacteria 7769
93 Ga0207695_10007788 3300025913 Bacteria 13563
94 Ga0207695_10010180 3300025913 Bacteria 11532
95 Ga0207695_10025610 3300025913 Bacteria 6599
96 Ga0207695_10156383 3300025913 Bacteria 2214
97 Ga0207693_10007049 3300025915 Bacteria 9275
98 Ga0207693_10086605 3300025915 Bacteria 2455
99 Ga0207663_10041286 3300025916 Bacteria 2811
100 Ga0207663_10189678 3300025916 Bacteria 1475
101 Ga0207660_10012532 3300025917 Bacteria 5551
102 Ga0207660_10038758 3300025917 Bacteria 3328
103 Ga0207652_10039014 3300025921 Bacteria 4029
104 Ga0207652_10107326 3300025921 Bacteria 2473
105 Ga0207646_10021596 3300025922 Bacteria 5943
106 Ga0207646_10330379 3300025922 Unclassified 1377
107 Ga0207650_10006824 3300025925 Bacteria 7788
108 Ga0207664_10082201 3300025929 Bacteria 2623
109 Ga0207669_10179507 3300025937 Unclassified 1516
110 Ga0207661_10060641 3300025944 Bacteria 3053
111 Ga0207679_10018391 3300025945 Bacteria 4681
112 Ga0207667_10017688 3300025949 Bacteria 8020
113 Ga0207667_10075615 3300025949 Bacteria 3496
114 Ga0207667_10092934 3300025949 Bacteria 3115
115 Ga0207667_10167425 3300025949 Bacteria 2259
116 Ga0207677_10003472 3300026023 Bacteria 8357
117 Ga0207703_10006236 3300026035 Bacteria 9539
118 Ga0207702_10003168 3300026078 Bacteria 15219
119 Ga0207702_10131666 3300026078 Unclassified 2251
120 Ga0207641_10056175 3300026088 Unclassified 3345
121 Ga0207641_10238174 3300026088 Bacteria 1694
122 Ga0207641_10308686 3300026088 Bacteria 1496
123 Ga0207648_10014764 3300026089 Bacteria 7205
124 Ga0207676_10077547 3300026095 Bacteria 2688
125 Ga0207674_10005640 3300026116 Bacteria 14842
126 Ga0207674_10115542 3300026116 Bacteria 2655
127 Ga0207698_10024467 3300026142 Bacteria 4238
128 Ga0268264_10231272 3300028381 Bacteria 1707
129 Ga0265337_1002057 3300028556 Bacteria 9521
130 Ga0265337_1005328 3300028556 Bacteria 5134
131 Ga0265338_10061803 3300028800 Bacteria 3280
132 Ga0265338_10074716 3300028800 Unclassified 2880
133 Ga0265338_10193414 3300028800 Bacteria 1540
134 Ga0265324_10012688 3300029957 Bacteria 3171
135 Ga0265328_10023825 3300031239 Bacteria 2319
136 Ga0265320_10008130 3300031240 Bacteria 6445
137 Ga0265320_10053087 3300031240 Bacteria 1960
138 Ga0265329_10001970 3300031242 Bacteria 9631
139 Ga0265340_10011860 3300031247 Bacteria 4617
140 Ga0265316_10000832 3300031344 Bacteria 34185
141 Ga0265316_10044320 3300031344 Bacteria 3538
142 Ga0265316_10073597 3300031344 Unclassified 2631
143 Ga0265314_10000079 3300031711 Bacteria 144215
144 Ga0265314_10002054 3300031711 Bacteria 21261
145 Ga0265314_10030144 3300031711 Bacteria 4020
146 Ga0265342_10020365 3300031712 Bacteria 4257
147 Ga0373932_0017594 3300035112 Bacteria 1837
148 Ga0373947_0032495 3300035725 Bacteria 3076
149 Ga0373937_0254129 3300036401 Bacteria 1657
150 Ga0395898_0042415 3300037466 Bacteria 4489
151 Ga0436364_0897591 3300037853 Unclassified 1641
152 Ga0436365_1911883 3300039437 Bacteria 5768
153 Ga0436361_0918063 3300039447 Bacteria 3071
154 Ga0466963_0237401 3300044694 Bacteria 1278
155 Ga0451576_0320849 3300045051 Bacteria 1621
156 Ga0451576_0394471 3300045051 Bacteria 1451
157 Ga0466967_0063873 3300045976 Bacteria 3273
158 Ga0466967_0080370 3300045976 Bacteria 2941
159 Ga0495580_0023148 3300046472 Bacteria 4565
160 Ga0495580_0046198 3300046472 Bacteria 3091
161 Ga0495582_0098296 3300046473 Bacteria 1637
162 Ga0495613_0042931 3300046689 Unclassified 3345
163 Ga0495600_0048020 3300046809 Bacteria 2785
164 Ga0495604_0149315 3300047317 Bacteria 1662
165 Ga0501033_0036235 3300049570 Bacteria 3698
166 Ga0501034_0033649 3300049571 Bacteria 5198
167 Ga0501034_0142069 3300049571 Unclassified 2379
168 Ga0501036_0028205 3300049572 Unclassified 4746
169 Ga0501037_0011985 3300049573 Bacteria 6386
170 Ga0501037_0059207 3300049573 Bacteria 2795
171 Ga0501038_0005288 3300049574 Bacteria 12004
172 Ga0501039_0031287 3300049575 Unclassified 4102
173 Ga0501043_0000825 3300049579 Bacteria 27474
174 Ga0501046_0002552 3300049580 Bacteria 17036
175 Ga0501047_0109990 3300049581 Bacteria 2638
176 Ga0501048_0030557 3300049582 Unclassified 3897
177 Ga0501067_0057815 3300049583 Unclassified 2147
178 Ga0501068_0002862 3300049584 Bacteria 9183
179 Ga0501069_0002761 3300049585 Bacteria 8973
180 Ga0501070_0006919 3300049586 Bacteria 9652
181 Ga0501070_0064648 3300049586 Bacteria 3029
182 Ga0501072_0002347 3300049588 Bacteria 14193
183 Ga0501074_0009107 3300049590 Bacteria 7210
184 Ga0501076_0032538 3300049592 Bacteria 4070
185 Ga0501077_0037815 3300049593 Unclassified 3073
186 Ga0501079_0038105 3300049741 Unclassified 3708
187 Ga0501079_0139538 3300049741 Unclassified 1888
188 Ga0501080_0041517 3300049742 Unclassified 4285
189 Ga0501268_007181 3300049765 Bacteria 1656
190 Ga0501035_0029468 3300049822 Bacteria 5005
191 Ga0501044_0039118 3300049823 Unclassified 4949
192 nmdc:mga0n895_23730_c1 3300050512 Bacteria 5769
193 nmdc:mga08x19_12140_c1 3300050514 Bacteria 5185
194 nmdc:mga0a205_80691_c1 3300050515 Unclassified 3143
195 Ga0501084_0009514 3300054114 Bacteria 8041
196 Ga0501082_0027687 3300060353 Unclassified 4878
197 Ga0207665_10231330
198 Ga0070683_100019107
199 Ga0070670_100011333
200 Ga0070680_100058257
201 Ga0070680_100059790
202 Ga0068868_100063511
203 Ga0070687_100045781
204 Ga0070675_100281961
205 Ga0070674_100201182
206 Ga0070674_100213459
207 Ga0070709_10032769
208 Ga0070709_10050474
209 Ga0070714_100060401
210 Ga0070713_100033872
211 Ga0070713_100133443
212 Ga0070711_100049916
213 Ga0070705_100050775
214 Ga0070708_100008426
215 Ga0070708_100042680
216 Ga0070708_100273370
217 Ga0070681_10014814
218 Ga0070681_10086483
219 Ga0068867_100002053
220 Ga0070706_100043174
221 Ga0070706_100109442
222 Ga0070706_100168534
223 Ga0070707_100043971
224 Ga0070707_100078221
225 Ga0070698_100047684
226 Ga0070679_100052688
227 Ga0070679_100150885
228 Ga0070684_100052821
229 Ga0070684_100174343
230 Ga0068853_100031278
231 Ga0070665_100112514
232 Ga0070665_100146272
233 Ga0068855_100012373
234 Ga0068855_100019186
235 Ga0068855_100110523
236 Ga0068855_100530603
237 Ga0070664_100002287
238 Ga0068857_100003176
239 Ga0068857_100096093
240 Ga0068854_100001451
241 Ga0068856_100003086
242 Ga0068856_100182913
243 Ga0068852_100007789
244 Ga0068859_100003224
245 Ga0068863_100262391
246 Ga0068858_100002226
247 Ga0068860_100016394
248 Ga0081455_10026423
249 Ga0070717_10000519
250 Ga0070717_10013635
251 Ga0070717_10030256
252 Ga0070716_100096935
253 Ga0070712_100003144
254 Ga0070712_100031917
255 Ga0070712_100075471
256 Ga0068871_100027329
257 Ga0075430_100023162
258 Ga0075433_10061751
259 Ga0075434_100003557
260 Ga0075436_100013144
261 Ga0097620_100003224
262 Ga0105240_10001187
263 Ga0105240_10005709
264 Ga0105240_10007053
265 Ga0105240_10163265
266 Ga0105245_10008380
267 Ga0105245_10320452
268 Ga0105241_10014326
269 Ga0105242_10004847
270 Ga0105248_10120152
271 Ga0105248_10151316
272 Ga0105237_10001552
273 Ga0105249_10061740
274 Ga0105249_10096961
275 Ga0105246_10084978
276 Ga0157373_10020350
277 Ga0157370_10001003
278 Ga0157370_10001529
279 Ga0157369_10077860
280 Ga0157374_10000935
281 Ga0157378_10000416
282 Ga0163162_10048317
283 Ga0163162_10163809
284 Ga0157372_10108151
285 Ga0207642_10078791
286 Ga0207647_10016614
287 Ga0207654_10044528
288 Ga0207707_10011312
289 Ga0207695_10007788
290 Ga0207695_10010180
291 Ga0207695_10025610
292 Ga0207695_10156383
293 Ga0207693_10007049
294 Ga0207693_10086605
295 Ga0207663_10041286
296 Ga0207663_10189678
297 Ga0207660_10012532
298 Ga0207660_10038758
299 Ga0207652_10039014
300 Ga0207652_10107326
301 Ga0207646_10021596
302 Ga0207646_10330379
303 Ga0207650_10006824
304 Ga0207664_10082201
305 Ga0207669_10179507
306 Ga0207661_10060641
307 Ga0207679_10018391
308 Ga0207667_10017688
309 Ga0207667_10075615
310 Ga0207667_10092934
311 Ga0207667_10167425
312 Ga0207677_10003472
313 Ga0207703_10006236
314 Ga0207702_10003168
315 Ga0207702_10131666
316 Ga0207641_10056175
317 Ga0207641_10238174
318 Ga0207641_10308686
319 Ga0207648_10014764
320 Ga0207676_10077547
321 Ga0207674_10005640
322 Ga0207674_10115542
323 Ga0207698_10024467
324 Ga0268264_10231272
325 Ga0265337_1002057
326 Ga0265337_1005328
327 Ga0265338_10061803
328 Ga0265338_10074716
329 Ga0265338_10193414
330 Ga0265324_10012688
331 Ga0265328_10023825
332 Ga0265320_10008130
333 Ga0265320_10053087
334 Ga0265329_10001970
335 Ga0265340_10011860
336 Ga0265316_10000832
337 Ga0265316_10044320
338 Ga0265316_10073597
339 Ga0265314_10000079
340 Ga0265314_10002054
341 Ga0265314_10030144
342 Ga0265342_10020365
343 Ga0373932_0017594
344 Ga0373947_0032495
345 Ga0373937_0254129
346 Ga0395898_0042415
347 Ga0436364_0897591
348 Ga0436365_1911883
349 Ga0436361_0918063
350 Ga0466963_0237401
351 Ga0451576_0320849
352 Ga0451576_0394471
353 Ga0466967_0063873
354 Ga0466967_0080370
355 Ga0495580_0023148
356 Ga0495580_0046198
357 Ga0495582_0098296
358 Ga0495613_0042931
359 Ga0495600_0048020
360 Ga0495604_0149315
361 Ga0501033_0036235
362 Ga0501034_0033649
363 Ga0501034_0142069
364 Ga0501036_0028205
365 Ga0501037_0011985
366 Ga0501037_0059207
367 Ga0501038_0005288
368 Ga0501039_0031287
369 Ga0501043_0000825
370 Ga0501046_0002552
371 Ga0501047_0109990
372 Ga0501048_0030557
373 Ga0501067_0057815
374 Ga0501068_0002862
375 Ga0501069_0002761
376 Ga0501070_0006919
377 Ga0501070_0064648
378 Ga0501072_0002347
379 Ga0501074_0009107
380 Ga0501076_0032538
381 Ga0501077_0037815
382 Ga0501079_0038105
383 Ga0501079_0139538
384 Ga0501080_0041517
385 Ga0501268_007181
386 Ga0501035_0029468
387 Ga0501044_0039118
388 nmdc:mga0n895_23730_c1
389 nmdc:mga08x19_12140_c1
390 nmdc:mga0a205_80691_c1
391 Ga0501084_0009514
392 Ga0501082_0027687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14759

Reductase_C

Reductase C-terminal

322

406

0.94

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

4

303

0.93

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

148

228

0.92

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

65

277

0.81

PF21791

MDHAR3-like_C

Monodehydroascorbate reductase 3-like, C-terminal domain

320

405

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9722 147 178
3ef6-assembly1.cif.gz_A crystal structure of toluene 2,3-dioxygenase reductase 0.9543 4 405
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9517 4 405
4b3j-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase and thiolase active sites 0.95 146 178
6krt-assembly2.cif.gz_B monodehydroascorbate reductase, mdhar, from antarctic hairgrass deschampsia antarctica 0.9494 2 397
ID Description Score Start End Superfamily
af_A0A0R0JZ96_141_231_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9862 121 206 3.50.50.60
5jclB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9817 119 240 3.50.50.60
1vkzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9747 148 175 3.40.50.20
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9733 117 240 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9732 147 208 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2C9PGL8-F1-model_v4 Monodehydroascorbate reductase (EC 1.6.5.4) 0.9641 2 217 GO:0005737
GO:0016656
AF-A0A2E0LK78-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9624 1 400 GO:0005737
GO:0016651
AF-A0A562K816-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit 0.9608 2 405 GO:0005737
GO:0016651
GO:0051213
AF-J8V808-F1-model_v4 deleted 0.9593 10 357
AF-A0A2D8HDT9-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9586 4 403 GO:0005737
GO:0016651

Map