F301486

General Info

Members Datasets Scaffolds Average Seq Length
196 140 392 212

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10628115|Ga0105245_106281151
Length 236
Sequence LLCFIIAKKGYYLNIENFTGGYKMKIGVVGATGKAGSFIVKEALNRGHDVTAIVRDASKVDERDVRTLEKDIFDITAKDIEGLDAVVNAFGAPEGKEHLHVEAGQSLIRVFKHAPDVRLLVVGGAGSLFVDEEKTTRLADTPDFPKEYKATADNQAQNLKDLESTSDINWTFISPAAFFNPSGKRTDAYKTGKDHVILNSEGNSHVSYADYAIAVIDEIERGEHVNERFTVVSDAR

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
37 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
38 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
39 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
40 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
41 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
42 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
43 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
44 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
45 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
46 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
47 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
48 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
49 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
50 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
56 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
57 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
58 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
70 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
71 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
72 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
73 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
81 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
82 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
83 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
84 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
85 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
86 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
87 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
88 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
89 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
90 2643221729 Bacillus sp. Root11 Isolate Unclassified
91 2643221730 Bacillus sp. Root131 Isolate Unclassified
92 2643221731 Bacillus sp. Root147 Isolate Unclassified
93 2643221732 Bacillus sp. Root239 Isolate Unclassified
94 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
95 2738541358 Bacillus sp. OV752 Isolate Unclassified
96 2738543006 Bacillus sp. OK077 Isolate Unclassified
97 2738543010 Bacillus sp. YR335 Isolate Unclassified
98 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
99 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
100 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
101 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
102 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
103 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
104 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
105 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
106 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
107 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
108 2842682962 Bacillus sp. R-72492 Isolate Unclassified
109 2842882022 Bacillus sp. R-71893 Isolate Unclassified
110 2849139964 Bacillus sp. R-71875 Isolate Unclassified
111 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
112 2857581216 Bacillus sp. R-71922 Isolate Unclassified
113 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
114 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
115 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
116 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
117 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
118 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
119 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
120 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
121 2919720352 Priestia megaterium 4340 Isolate Unclassified
122 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
123 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
124 2929004312 Priestia megaterium 1104 Isolate Unclassified
125 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
126 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
127 2938917290 Bacillus sp. CR71 Isolate Unclassified
128 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
129 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
130 2965761152 Bacillus sp. COPE52 Isolate Unclassified
131 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
132 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
133 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
134 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
135 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
136 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
137 8023444577 Bacillus sp. BH32 Isolate Unclassified
138 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
139 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
140 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.82
Metatranscriptomes 2.55
Isolates 31.63

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 11.22
Nodule 0.51
Rhizoplane 16.84
Rhizosphere 34.18
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10628115 3300009098 Bacteria 1103
2 JGI25159J45721_1003571 3300002987 Bacteria 5449
3 JGI25159J45721_1012635 3300002987 Bacteria 2003
4 JGI25151J46595_10003402 3300003187 Bacteria 8807
5 JGI25151J46595_10003812 3300003187 Bacteria 8175
6 JGI25151J46595_10008831 3300003187 Bacteria 4817
7 rootH1_10004819 3300003316 Bacteria 11553
8 rootH2_10052087 3300003320 Bacteria 8052
9 rootH2_10127877 3300003320 Bacteria 2330
10 rootL2_10015961 3300003322 Bacteria 4216
11 Ga0055538_1000080 3300003751 Bacteria 85194
12 Ga0055532_1003915 3300003758 Bacteria 2381
13 Ga0055536_1004874 3300003781 Bacteria 6698
14 Ga0055528_1028715 3300003790 Bacteria 1527
15 Ga0070670_100734671 3300005331 Bacteria 889
16 Ga0070671_100534957 3300005355 Bacteria 1010
17 Ga0105251_10045817 3300009011 Bacteria 2107
18 Ga0105244_10006532 3300009036 Bacteria 7524
19 Ga0105244_10088522 3300009036 Bacteria 1525
20 Ga0105250_10002175 3300009092 Bacteria 10038
21 Ga0105250_10008061 3300009092 Bacteria 4491
22 Ga0105250_10018060 3300009092 Bacteria 2860
23 Ga0105240_10000237 3300009093 Bacteria 109895
24 Ga0105247_10550061 3300009101 Bacteria 848
25 Ga0105243_10005602 3300009148 Bacteria 9785
26 Ga0105237_10000589 3300009545 Bacteria 50628
27 Ga0105237_10391577 3300009545 Bacteria 1394
28 Ga0105238_10264176 3300009551 Bacteria 1701
29 Ga0105246_10051792 3300011119 Bacteria 2820
30 Ga0157371_10043855 3300013102 Bacteria 3185
31 Ga0157374_10015105 3300013296 Bacteria 6769
32 Ga0157374_10281049 3300013296 Bacteria 1643
33 Ga0209784_100077 3300025224 Bacteria 139569
34 Ga0209147_100028 3300025229 Bacteria 383994
35 Ga0209147_100086 3300025229 Bacteria 182078
36 Ga0209147_100407 3300025229 Bacteria 29133
37 Ga0209673_1005437 3300025273 Bacteria 6398
38 Ga0209676_1000277 3300025292 Bacteria 106682
39 Ga0209025_1000757 3300025294 Bacteria 53988
40 Ga0209025_1002045 3300025294 Bacteria 22979
41 Ga0209025_1010221 3300025294 Bacteria 6395
42 Ga0209025_1027740 3300025294 Bacteria 2798
43 Ga0209025_1029256 3300025294 Bacteria 2672
44 Ga0209025_1133107 3300025294 Bacteria 718
45 Ga0207696_1002969 3300025711 Bacteria 7937
46 Ga0207696_1003960 3300025711 Bacteria 6522
47 Ga0207696_1013022 3300025711 Bacteria 2918
48 Ga0207655_1006446 3300025728 Bacteria 7774
49 Ga0207655_1008221 3300025728 Bacteria 6651
50 Ga0207655_1033642 3300025728 Bacteria 2319
51 Ga0207655_1050992 3300025728 Bacteria 1677
52 Ga0207713_1003910 3300025735 Bacteria 9912
53 Ga0207713_1015641 3300025735 Bacteria 3885
54 Ga0207644_10249200 3300025931 Bacteria 1417
55 Ga0207709_10039066 3300025935 Bacteria 2832
56 Ga0307408_100897515 3300031548 Bacteria 811
57 Ga0307416_100179407 3300032002 Bacteria 1983
58 Ga0237819_00348 3300038705 Bacteria 16676
59 Ga0237819_00637 3300038705 Bacteria 11433
60 Ga0439462_0015251 3300042015 Bacteria 1979
61 Ga0466963_0616177 3300044694 Bacteria 766
62 Ga0466967_0009036 3300045976 Bacteria 7366
63 Ga0466967_0096419 3300045976 Bacteria 2698
64 Ga0495603_0132597 3300046455 Bacteria 1450
65 Ga0495590_0140458 3300046457 Bacteria 871
66 Ga0495584_0221314 3300046491 Bacteria 962
67 Ga0495585_0066273 3300046492 Bacteria 1977
68 Ga0495652_0651519 3300046529 Eukaryota 713
69 Ga0495640_0006842 3300046533 Eukaryota 8984
70 Ga0495634_0001450 3300046642 Eukaryota 21071
71 Ga0495657_0001511 3300046675 Eukaryota 20019
72 Ga0495613_0003930 3300046689 Eukaryota 11131
73 Ga0495676_0281679 3300047321 Eukaryota 1125
74 Ga0495680_0002102 3300047322 Eukaryota 20688
75 Ga0496100_0005487 3300048903 Bacteria 6836
76 Ga0496100_0062281 3300048903 Bacteria 2461
77 Ga0496100_0723218 3300048903 Bacteria 778
78 Ga0496101_0019455 3300048904 Bacteria 4635
79 Ga0496101_0028691 3300048904 Bacteria 3887
80 Ga0496102_0004212 3300048905 Bacteria 12165
81 Ga0496103_0006750 3300048906 Bacteria 6849
82 Ga0496104_0000902 3300048907 Bacteria 25475
83 Ga0496104_0062516 3300048907 Bacteria 3530
84 Ga0496104_0601276 3300048907 Bacteria 1010
85 Ga0496104_1173481 3300048907 Bacteria 671
86 Ga0496105_0000545 3300048908 Bacteria 24864
87 Ga0496106_0000516 3300048909 Bacteria 27412
88 Ga0496107_0001083 3300048910 Bacteria 16341
89 Ga0496108_0002088 3300048911 Bacteria 15989
90 Ga0496108_0366777 3300048911 Bacteria 1257
91 Ga0496108_0789059 3300048911 Bacteria 820
92 Ga0496109_0000764 3300048912 Bacteria 26747
93 Ga0496109_1154591 3300048912 Bacteria 711
94 Ga0496110_0027188 3300048913 Bacteria 4902
95 Ga0496110_0146622 3300048913 Bacteria 2135
96 Ga0496110_0452150 3300048913 Bacteria 1170
97 Ga0496111_0193322 3300048914 Bacteria 1513
98 Ga0496112_0013165 3300048915 Bacteria 7632
99 Ga0496112_0075594 3300048915 Bacteria 3331
100 Ga0496112_0336770 3300048915 Bacteria 1452
101 Ga0496113_0002238 3300048916 Bacteria 11176
102 Ga0496113_0103953 3300048916 Bacteria 2204
103 Ga0496115_0162636 3300048918 Bacteria 1845
104 Ga0496115_0579461 3300048918 Bacteria 894
105 Ga0496116_0000213 3300048919 Bacteria 109134
106 Ga0496116_0002688 3300048919 Bacteria 18362
107 Ga0496118_0035191 3300048921 Bacteria 4072
108 Ga0496119_0001124 3300048922 Bacteria 33715
109 Ga0496119_0005197 3300048922 Bacteria 12577
110 Ga0496119_0037199 3300048922 Bacteria 3165
111 Ga0496119_0144945 3300048922 Bacteria 1278
112 Ga0496120_0000003 3300048923 Bacteria 538703
113 Ga0496120_0000743 3300048923 Bacteria 47515
114 Ga0496120_0003302 3300048923 Bacteria 14828
115 Ga0496120_0071316 3300048923 Bacteria 1907
116 Ga0496122_0002100 3300048925 Bacteria 29521
117 Ga0496122_0023362 3300048925 Bacteria 5453
118 Ga0496122_0034399 3300048925 Bacteria 4146
119 Ga0496122_0039182 3300048925 Bacteria 3782
120 Ga0496123_0001689 3300048926 Bacteria 29521
121 Ga0496124_0225414 3300048927 Bacteria 1406
122 Ga0496125_0000027 3300048928 Bacteria 397211
123 Ga0496125_0010513 3300048928 Bacteria 9359
124 Ga0496125_0076236 3300048928 Bacteria 2590
125 Ga0496125_0434162 3300048928 Bacteria 757
126 Ga0496126_0002284 3300048929 Bacteria 26409
127 Ga0496126_0114638 3300048929 Bacteria 2344
128 Ga0496126_0187028 3300048929 Unclassified 1756
129 Ga0501312_051639 3300049528 Bacteria 695
130 Ga0501326_01691 3300049542 Bacteria 1042
131 Ga0501332_04701 3300049548 Bacteria 821
132 Ga0501334_00872 3300049550 Bacteria 1548
133 Ga0501335_006344 3300049551 Bacteria 1076
134 nmdc:mga00v17_411042_c1 3300050491 Unclassified 879
135 2512637173 2512564013 Bacteria 6286191
136 2512731890 2512564039 Bacteria 8739048
137 2563929161 2563366752 Bacteria 4961801
138 2573039198 2571042588 Bacteria 5045676
139 2580931687 2579778775 Bacteria 5360914
140 2595090484 2593339131 Bacteria 5116855
141 2600198839 2599185353 Bacteria 2219443
142 2600401896 2600254943 Bacteria 2613887
143 2621274508 2619619294 Bacteria 5575484
144 2644707348 2643221729 Bacteria 6621700
145 2644714305 2643221730 Bacteria 6523787
146 2644716363 2643221731 Bacteria 5623886
147 2644723766 2643221732 Bacteria 5756404
148 2672338095 2671180330 Bacteria 5521719
149 2739157194 2738541358 Bacteria 5932299
150 2739209056 2738543006 Bacteria 5904091
151 2739234758 2738543010 Bacteria 5583595
152 2757567230 2757320391 Bacteria 4746095
153 2777761728 2775507177 Bacteria 4384303
154 2777837327 2775507192 Bacteria 4622234
155 2791213423 2788500588 Bacteria 4584915
156 2808867284 2808606364 Bacteria 4465927
157 2816861430 2816332186 Bacteria 5331395
158 2817481991 2816332295 Bacteria 4352468
159 2819582471 2818991443 Bacteria 6598732
160 2819627470 2818991451 Bacteria 4697364
161 2819709829 2818991465 Bacteria 5388835
162 2842687185 2842682962 Bacteria 5589973
163 2842883905 2842882022 Bacteria 6158489
164 2849143688 2849139964 Bacteria 5613304
165 2857462024 2857460504 Bacteria 5194327
166 2857586338 2857581216 Bacteria 5522813
167 2865004491 2865002811 Bacteria 6333767
168 2889052624 2889049205 Bacteria 7524325
169 2904525064 2904524088 Bacteria 5887454
170 2904608550 2904606771 Bacteria 4684500
171 2915598511 2915597211 Bacteria 6475886
172 2915609118 2915606848 Bacteria 6032732
173 2919146347 2919143609 Bacteria 6219228
174 2919148952 2919143609 Bacteria 6219228
175 2919518263 2919517244 Bacteria 5858162
176 2919523255 2919517244 Bacteria 5858162
177 2919722621 2919720352 Bacteria 5986006
178 2925332209 2925326138 Bacteria 9652120
179 2928096817 2928093941 Bacteria 5965005
180 2929005776 2929004312 Bacteria 5678476
181 2929183653 2929183550 Bacteria 6377511
182 2936344713 2936340661 Bacteria 5139038
183 2938922957 2938917290 Bacteria 5914775
184 2960320246 2960319331 Bacteria 5502575
185 2960379512 2960375949 Bacteria 5361395
186 2965766359 2965761152 Bacteria 5806513
187 2984531680 2984527788 Bacteria 5288478
188 2984532932 2984532647 Bacteria 5288506
189 3006862419 3006858327 Bacteria 4317835
190 3006973275 3006969106 Bacteria 4739423
191 8022895464 8022893055 Bacteria 5300455
192 8022916754 8022914991 Bacteria 5584517
193 8023448730 8023444577 Bacteria 5661597
194 8055636914 8055632911 Bacteria 5283357
195 8057475409 8057473075 Bacteria 5892720
196 8057735636 8057733483 Bacteria 6578323
197 Ga0105245_10628115
198 JGI25159J45721_1003571
199 JGI25159J45721_1012635
200 JGI25151J46595_10003402
201 JGI25151J46595_10003812
202 JGI25151J46595_10008831
203 rootH1_10004819
204 rootH2_10052087
205 rootH2_10127877
206 rootL2_10015961
207 Ga0055538_1000080
208 Ga0055532_1003915
209 Ga0055536_1004874
210 Ga0055528_1028715
211 Ga0070670_100734671
212 Ga0070671_100534957
213 Ga0105251_10045817
214 Ga0105244_10006532
215 Ga0105244_10088522
216 Ga0105250_10002175
217 Ga0105250_10008061
218 Ga0105250_10018060
219 Ga0105240_10000237
220 Ga0105247_10550061
221 Ga0105243_10005602
222 Ga0105237_10000589
223 Ga0105237_10391577
224 Ga0105238_10264176
225 Ga0105246_10051792
226 Ga0157371_10043855
227 Ga0157374_10015105
228 Ga0157374_10281049
229 Ga0209784_100077
230 Ga0209147_100028
231 Ga0209147_100086
232 Ga0209147_100407
233 Ga0209673_1005437
234 Ga0209676_1000277
235 Ga0209025_1000757
236 Ga0209025_1002045
237 Ga0209025_1010221
238 Ga0209025_1027740
239 Ga0209025_1029256
240 Ga0209025_1133107
241 Ga0207696_1002969
242 Ga0207696_1003960
243 Ga0207696_1013022
244 Ga0207655_1006446
245 Ga0207655_1008221
246 Ga0207655_1033642
247 Ga0207655_1050992
248 Ga0207713_1003910
249 Ga0207713_1015641
250 Ga0207644_10249200
251 Ga0207709_10039066
252 Ga0307408_100897515
253 Ga0307416_100179407
254 Ga0237819_00348
255 Ga0237819_00637
256 Ga0439462_0015251
257 Ga0466963_0616177
258 Ga0466967_0009036
259 Ga0466967_0096419
260 Ga0495603_0132597
261 Ga0495590_0140458
262 Ga0495584_0221314
263 Ga0495585_0066273
264 Ga0495652_0651519
265 Ga0495640_0006842
266 Ga0495634_0001450
267 Ga0495657_0001511
268 Ga0495613_0003930
269 Ga0495676_0281679
270 Ga0495680_0002102
271 Ga0496100_0005487
272 Ga0496100_0062281
273 Ga0496100_0723218
274 Ga0496101_0019455
275 Ga0496101_0028691
276 Ga0496102_0004212
277 Ga0496103_0006750
278 Ga0496104_0000902
279 Ga0496104_0062516
280 Ga0496104_0601276
281 Ga0496104_1173481
282 Ga0496105_0000545
283 Ga0496106_0000516
284 Ga0496107_0001083
285 Ga0496108_0002088
286 Ga0496108_0366777
287 Ga0496108_0789059
288 Ga0496109_0000764
289 Ga0496109_1154591
290 Ga0496110_0027188
291 Ga0496110_0146622
292 Ga0496110_0452150
293 Ga0496111_0193322
294 Ga0496112_0013165
295 Ga0496112_0075594
296 Ga0496112_0336770
297 Ga0496113_0002238
298 Ga0496113_0103953
299 Ga0496115_0162636
300 Ga0496115_0579461
301 Ga0496116_0000213
302 Ga0496116_0002688
303 Ga0496118_0035191
304 Ga0496119_0001124
305 Ga0496119_0005197
306 Ga0496119_0037199
307 Ga0496119_0144945
308 Ga0496120_0000003
309 Ga0496120_0000743
310 Ga0496120_0003302
311 Ga0496120_0071316
312 Ga0496122_0002100
313 Ga0496122_0023362
314 Ga0496122_0034399
315 Ga0496122_0039182
316 Ga0496123_0001689
317 Ga0496124_0225414
318 Ga0496125_0000027
319 Ga0496125_0010513
320 Ga0496125_0076236
321 Ga0496125_0434162
322 Ga0496126_0002284
323 Ga0496126_0114638
324 Ga0496126_0187028
325 Ga0501312_051639
326 Ga0501326_01691
327 Ga0501332_04701
328 Ga0501334_00872
329 Ga0501335_006344
330 nmdc:mga00v17_411042_c1
331 2512637173
332 2512731890
333 2563929161
334 2573039198
335 2580931687
336 2595090484
337 2600198839
338 2600401896
339 2621274508
340 2644707348
341 2644714305
342 2644716363
343 2644723766
344 2672338095
345 2739157194
346 2739209056
347 2739234758
348 2757567230
349 2777761728
350 2777837327
351 2791213423
352 2808867284
353 2816861430
354 2817481991
355 2819582471
356 2819627470
357 2819709829
358 2842687185
359 2842883905
360 2849143688
361 2857462024
362 2857586338
363 2865004491
364 2889052624
365 2904525064
366 2904608550
367 2915598511
368 2915609118
369 2919146347
370 2919148952
371 2919518263
372 2919523255
373 2919722621
374 2925332209
375 2928096817
376 2929005776
377 2929183653
378 2936344713
379 2938922957
380 2960320246
381 2960379512
382 2965766359
383 2984531680
384 2984532932
385 3006862419
386 3006973275
387 8022895464
388 8022916754
389 8023448730
390 8055636914
391 8057475409
392 8057735636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

142

0.76

PF13460

NAD_binding_10

NAD(P)H-binding

30

221

0.74

PF05368

NmrA

NmrA-like family

26

228

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r01-assembly1.cif.gz_A crystal structure of sp1627, a putative nadh-flavin reductase, from streptococcus pneumoniae tigr4 0.959 1 210
4r01-assembly1.cif.gz_A crystal structure of sp1627, a putative nadh-flavin reductase, from streptococcus pneumoniae tigr4 0.9502 1 210
3h2s-assembly1.cif.gz_B crystal structure of the q03b84 protein from lactobacillus casei. northeast structural genomics consortium target lcr19. 0.9131 1 211
3h2s-assembly1.cif.gz_B crystal structure of the q03b84 protein from lactobacillus casei. northeast structural genomics consortium target lcr19. 0.9049 1 211
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.8976 1 209
ID Description Score Start End Superfamily
4r01B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 1 210 3.40.50.720
4r01B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 1 210 3.40.50.720
3h2sB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9053 3 211 3.40.50.720
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8952 1 209 3.40.50.720
3h2sB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.893 3 211 3.40.50.720
ID Description Score Start End GO Terms
AF-J8GPN9-F1-model_v4 deleted 0.9946 1 211
AF-A0A7Y8S713-F1-model_v4 deleted 0.9944 1 79
AF-A0A2C1BXN3-F1-model_v4 deleted 0.9939 1 212
AF-A0A2K8ZR11-F1-model_v4 deleted 0.9933 1 212
AF-J8HMD0-F1-model_v4 deleted 0.9933 1 212

Map