F301222

General Info

Members Datasets Scaffolds Average Seq Length
196 127 392 379

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100203015|Ga0070707_1002030151
Length 442
Sequence MVELVDDQFPNARLVRFIFGPSTCLVFLVGNHCRQSLARLPYFSAGENIALAYSVSHDAKRQRVTAHPISVVEVRSRSERDEFIKFPWRIYKNDRAWVPPLIIERRSFLDRNKHPFYQHGDAALFLAKRDDQIVGRIMASDDPNYNALHNSNVGCFGLFESIDDVDVARALFDSAADWLRRRGRSEIMGPIDYSTNYVCGLLIDGFEHPPTLLTAHNPPYYARLIEAYGFEKEKDWYAWWFVPTTPPLERLRPIAKARARKRLVKIRPIDLRHLSDDSRRLSAVFNEAWKNNWGFVPFTEAEAEHMAKEMRPVIDPRMTLIAEVDDAPVAFVICVPDINVALRHVNGRLMRFGLPIGLLQLLYRRSKIRTVRLVALGVVEKYRRTGIAEMLVLQVMEEGARRGFSAELSMTLEDNLLMNRFIEGLGASKYKTYRIYRRPINS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.14
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 15.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100203015 3300005468 Bacteria 1932
2 CNXas_1000252 3300000545 Bacteria 6194
3 JGI25406J46586_10000071 3300003203 Bacteria 46225
4 JGI25404J52841_10002627 3300003659 Unclassified 3428
5 JGI25405J52794_10000420 3300003911 Bacteria 5990
6 Ga0065712_10087862 3300005290 Unclassified 2551
7 Ga0065715_10000579 3300005293 Bacteria 15458
8 Ga0070676_10004331 3300005328 Bacteria 7457
9 Ga0070676_10067177 3300005328 Bacteria 2143
10 Ga0070690_100173467 3300005330 Bacteria 1485
11 Ga0070670_100249436 3300005331 Bacteria 1546
12 Ga0070677_10059400 3300005333 Bacteria 1573
13 Ga0070666_10024755 3300005335 Unclassified 3912
14 Ga0070666_10067508 3300005335 Bacteria 2428
15 Ga0068868_100009932 3300005338 Bacteria 6874
16 Ga0068868_100164129 3300005338 Bacteria 1836
17 Ga0070660_100206828 3300005339 Bacteria 1593
18 Ga0070689_100048580 3300005340 Bacteria 3273
19 Ga0070668_100002893 3300005347 Bacteria 12670
20 Ga0070668_100145226 3300005347 Bacteria 1914
21 Ga0070668_100302011 3300005347 Bacteria 1343
22 Ga0070669_100016021 3300005353 Bacteria 5349
23 Ga0070669_100048127 3300005353 Bacteria 3111
24 Ga0070669_100137066 3300005353 Bacteria 1883
25 Ga0070669_100138386 3300005353 Bacteria 1875
26 Ga0070675_100013519 3300005354 Bacteria 6416
27 Ga0070675_100084198 3300005354 Bacteria 2656
28 Ga0070671_100022843 3300005355 Bacteria 5111
29 Ga0070671_100185480 3300005355 Bacteria 1762
30 Ga0070671_100214037 3300005355 Bacteria 1635
31 Ga0070674_100088193 3300005356 Bacteria 2232
32 Ga0070673_100015428 3300005364 Bacteria 5365
33 Ga0070667_100010604 3300005367 Bacteria 7609
34 Ga0070713_100014395 3300005436 Bacteria 5874
35 Ga0070713_100186309 3300005436 Bacteria 1868
36 Ga0070711_100040786 3300005439 Unclassified 3133
37 Ga0070705_100061329 3300005440 Bacteria 2234
38 Ga0070708_100143859 3300005445 Bacteria 2213
39 Ga0070708_100232742 3300005445 Bacteria 1729
40 Ga0070678_100042582 3300005456 Bacteria 3228
41 Ga0070678_100049917 3300005456 Unclassified 3022
42 Ga0068867_100108813 3300005459 Unclassified 2126
43 Ga0070706_100000302 3300005467 Bacteria 59595
44 Ga0070706_100008568 3300005467 Bacteria 9531
45 Ga0070706_100093653 3300005467 Bacteria 2787
46 Ga0070706_100103035 3300005467 Bacteria 2653
47 Ga0070707_100000673 3300005468 Bacteria 33923
48 Ga0070707_100013797 3300005468 Bacteria 7566
49 Ga0070707_100020854 3300005468 Bacteria 6186
50 Ga0070707_100025757 3300005468 Bacteria 5583
51 Ga0070707_100059033 3300005468 Bacteria 3680
52 Ga0070707_100137657 3300005468 Bacteria 2375
53 Ga0070707_100173480 3300005468 Bacteria 2101
54 Ga0070698_100013736 3300005471 Bacteria 8570
55 Ga0070698_100025224 3300005471 Bacteria 6194
56 Ga0070699_100126352 3300005518 Unclassified 2252
57 Ga0070697_100012564 3300005536 Bacteria 6634
58 Ga0070697_100022937 3300005536 Bacteria 4963
59 Ga0070672_100234780 3300005543 Bacteria 1541
60 Ga0070686_100294526 3300005544 Bacteria 1201
61 Ga0070696_100075273 3300005546 Bacteria 2381
62 Ga0070693_100076650 3300005547 Bacteria 1982
63 Ga0070665_100035967 3300005548 Unclassified 4982
64 Ga0070665_100131330 3300005548 Bacteria 2506
65 Ga0070665_100149336 3300005548 Unclassified 2340
66 Ga0068856_100049564 3300005614 Unclassified 4139
67 Ga0070702_100166966 3300005615 Bacteria 1428
68 Ga0081455_10000517 3300005937 Bacteria 50023
69 Ga0081455_10001023 3300005937 Bacteria 35256
70 Ga0081540_1000013 3300005983 Bacteria 186009
71 Ga0081539_10000026 3300005985 Bacteria 330830
72 Ga0081539_10001656 3300005985 Bacteria 36112
73 Ga0070717_10005170 3300006028 Bacteria 9515
74 Ga0070717_10057477 3300006028 Bacteria 3216
75 Ga0070717_10090734 3300006028 Bacteria 2579
76 Ga0070715_10041996 3300006163 Bacteria 1919
77 Ga0070716_100075408 3300006173 Bacteria 1996
78 Ga0070712_100031583 3300006175 Bacteria 3569
79 Ga0097621_100004996 3300006237 Bacteria 9300
80 Ga0097621_100124322 3300006237 Bacteria 2190
81 Ga0075436_100004277 3300006914 Bacteria 9808
82 Ga0075436_100039901 3300006914 Bacteria 3239
83 Ga0075436_100061192 3300006914 Bacteria 2601
84 Ga0105240_10099103 3300009093 Bacteria 3548
85 Ga0105245_10183097 3300009098 Bacteria 2003
86 Ga0105245_10392660 3300009098 Bacteria 1385
87 Ga0114129_10020312 3300009147 Bacteria 9449
88 Ga0157371_10124265 3300013102 Unclassified 1835
89 Ga0157374_10020906 3300013296 Bacteria 5814
90 Ga0157374_10043838 3300013296 Bacteria 4134
91 Ga0157374_10053293 3300013296 Bacteria 3771
92 Ga0157374_10091641 3300013296 Bacteria 2899
93 Ga0157378_10031561 3300013297 Bacteria 4679
94 Ga0157378_10187839 3300013297 Unclassified 1947
95 Ga0163162_10060847 3300013306 Bacteria 3813
96 Ga0163162_10174451 3300013306 Bacteria 2275
97 Ga0157372_10040049 3300013307 Bacteria 5174
98 Ga0157372_10400145 3300013307 Bacteria 1600
99 Ga0157375_10009032 3300013308 Bacteria 8726
100 Ga0157379_10258970 3300014968 Bacteria 1580
101 Ga0157376_10010764 3300014969 Bacteria 6711
102 Ga0157376_10023835 3300014969 Unclassified 4798
103 Ga0163161_10019429 3300017792 Unclassified 4767
104 Ga0207697_10000232 3300025315 Bacteria 30248
105 Ga0207697_10001181 3300025315 Bacteria 14341
106 Ga0207697_10002693 3300025315 Bacteria 9080
107 Ga0207697_10010151 3300025315 Unclassified 4038
108 Ga0207682_10059903 3300025893 Bacteria 1591
109 Ga0207688_10000273 3300025901 Bacteria 23561
110 Ga0207688_10011830 3300025901 Unclassified 4749
111 Ga0207680_10028857 3300025903 Unclassified 3109
112 Ga0207680_10052796 3300025903 Bacteria 2437
113 Ga0207647_10081044 3300025904 Unclassified 1945
114 Ga0207645_10003341 3300025907 Bacteria 12231
115 Ga0207645_10174268 3300025907 Unclassified 1410
116 Ga0207684_10000042 3300025910 Bacteria 262010
117 Ga0207684_10024134 3300025910 Bacteria 5187
118 Ga0207684_10082017 3300025910 Bacteria 2745
119 Ga0207693_10015542 3300025915 Bacteria 6106
120 Ga0207693_10040816 3300025915 Bacteria 3655
121 Ga0207663_10007213 3300025916 Bacteria 5751
122 Ga0207646_10000590 3300025922 Bacteria 47383
123 Ga0207646_10002727 3300025922 Bacteria 20667
124 Ga0207646_10011566 3300025922 Bacteria 8532
125 Ga0207646_10051848 3300025922 Bacteria 3671
126 Ga0207646_10072236 3300025922 Unclassified 3082
127 Ga0207646_10278028 3300025922 Unclassified 1513
128 Ga0207650_10044854 3300025925 Bacteria 3251
129 Ga0207659_10088296 3300025926 Bacteria 2309
130 Ga0207700_10150297 3300025928 Bacteria 1924
131 Ga0207700_10205678 3300025928 Bacteria 1661
132 Ga0207644_10011290 3300025931 Bacteria 5904
133 Ga0207644_10126501 3300025931 Bacteria 1951
134 Ga0207706_10054210 3300025933 Bacteria 3539
135 Ga0207669_10011053 3300025937 Bacteria 4375
136 Ga0207665_10083278 3300025939 Bacteria 2206
137 Ga0207691_10004227 3300025940 Bacteria 13948
138 Ga0207691_10021894 3300025940 Bacteria 6033
139 Ga0207651_10094298 3300025960 Bacteria 2200
140 Ga0207651_10126592 3300025960 Unclassified 1947
141 Ga0207668_10135819 3300025972 Bacteria 1884
142 Ga0207677_10116330 3300026023 Bacteria 2002
143 Ga0207641_10174604 3300026088 Bacteria 1964
144 Ga0207683_10004690 3300026121 Bacteria 11783
145 Ga0207683_10062290 3300026121 Bacteria 3285
146 Ga0207683_10090066 3300026121 Bacteria 2731
147 Ga0268266_10011451 3300028379 Bacteria 7712
148 Ga0373943_0022374 3300035170 Bacteria 2929
149 Ga0373931_0112046 3300035691 Bacteria 1549
150 Ga0373935_0117311 3300035692 Unclassified 1774
151 Ga0373947_0007298 3300035725 Bacteria 6399
152 Ga0373937_0062337 3300036401 Bacteria 3428
153 Ga0395901_0002989 3300038443 Bacteria 17051
154 Ga0395901_0292903 3300038443 Unclassified 1689
155 Ga0436363_0766707 3300039450 Bacteria 3721
156 Ga0451807_0621926 3300041486 Unclassified 1689
157 Ga0495651_0010540 3300046462 Bacteria 7103
158 Ga0495598_0041103 3300046537 Unclassified 1351
159 Ga0495645_0088373 3300046543 Bacteria 2217
160 Ga0495658_0088656 3300046683 Unclassified 1829
161 Ga0496102_0007535 3300048905 Bacteria 9303
162 Ga0496102_0343356 3300048905 Bacteria 1406
163 Ga0496103_0014508 3300048906 Unclassified 4677
164 Ga0496104_0093715 3300048907 Bacteria 2873
165 Ga0496104_0269566 3300048907 Unclassified 1615
166 Ga0496106_0160527 3300048909 Bacteria 1777
167 Ga0496107_0009484 3300048910 Bacteria 6750
168 Ga0496109_0145122 3300048912 Bacteria 2220
169 Ga0496112_0010614 3300048915 Bacteria 8367
170 Ga0496112_0176981 3300048915 Unclassified 2098
171 Ga0496113_0148765 3300048916 Bacteria 1846
172 Ga0496114_0309118 3300048917 Bacteria 1396
173 Ga0496115_0014169 3300048918 Bacteria 6033
174 Ga0501036_0010307 3300049572 Bacteria 7710
175 Ga0501039_0002219 3300049575 Bacteria 14361
176 Ga0501039_0149999 3300049575 Bacteria 1832
177 Ga0501040_0009390 3300049576 Bacteria 6373
178 Ga0501041_0003467 3300049577 Bacteria 9076
179 Ga0501042_0012831 3300049578 Bacteria 5690
180 Ga0501043_0157399 3300049579 Bacteria 1777
181 Ga0501046_0005038 3300049580 Bacteria 11855
182 Ga0501069_0123721 3300049585 Bacteria 1478
183 Ga0501071_0004883 3300049587 Bacteria 8547
184 Ga0501072_0009389 3300049588 Bacteria 7439
185 Ga0501074_0008120 3300049590 Bacteria 7606
186 Ga0501075_0016629 3300049591 Bacteria 5303
187 Ga0501079_0011995 3300049741 Bacteria 6615
188 Ga0501080_0018413 3300049742 Bacteria 6464
189 Ga0501081_0221335 3300049743 Bacteria 1376
190 Ga0501083_0153573 3300049744 Bacteria 1507
191 Ga0501045_0010178 3300049824 Bacteria 6581
192 nmdc:mga05p37_20633_c1 3300050507 Bacteria 7971
193 nmdc:mga08x19_75676_c1 3300050514 Bacteria 1832
194 nmdc:mga08x19_9831_c1 3300050514 Bacteria 5731
195 Ga0501084_0016222 3300054114 Bacteria 6184
196 Ga0530510_0107555 3300061734 Bacteria 2041
197 Ga0070707_100203015
198 CNXas_1000252
199 JGI25406J46586_10000071
200 JGI25404J52841_10002627
201 JGI25405J52794_10000420
202 Ga0065712_10087862
203 Ga0065715_10000579
204 Ga0070676_10004331
205 Ga0070676_10067177
206 Ga0070690_100173467
207 Ga0070670_100249436
208 Ga0070677_10059400
209 Ga0070666_10024755
210 Ga0070666_10067508
211 Ga0068868_100009932
212 Ga0068868_100164129
213 Ga0070660_100206828
214 Ga0070689_100048580
215 Ga0070668_100002893
216 Ga0070668_100145226
217 Ga0070668_100302011
218 Ga0070669_100016021
219 Ga0070669_100048127
220 Ga0070669_100137066
221 Ga0070669_100138386
222 Ga0070675_100013519
223 Ga0070675_100084198
224 Ga0070671_100022843
225 Ga0070671_100185480
226 Ga0070671_100214037
227 Ga0070674_100088193
228 Ga0070673_100015428
229 Ga0070667_100010604
230 Ga0070713_100014395
231 Ga0070713_100186309
232 Ga0070711_100040786
233 Ga0070705_100061329
234 Ga0070708_100143859
235 Ga0070708_100232742
236 Ga0070678_100042582
237 Ga0070678_100049917
238 Ga0068867_100108813
239 Ga0070706_100000302
240 Ga0070706_100008568
241 Ga0070706_100093653
242 Ga0070706_100103035
243 Ga0070707_100000673
244 Ga0070707_100013797
245 Ga0070707_100020854
246 Ga0070707_100025757
247 Ga0070707_100059033
248 Ga0070707_100137657
249 Ga0070707_100173480
250 Ga0070698_100013736
251 Ga0070698_100025224
252 Ga0070699_100126352
253 Ga0070697_100012564
254 Ga0070697_100022937
255 Ga0070672_100234780
256 Ga0070686_100294526
257 Ga0070696_100075273
258 Ga0070693_100076650
259 Ga0070665_100035967
260 Ga0070665_100131330
261 Ga0070665_100149336
262 Ga0068856_100049564
263 Ga0070702_100166966
264 Ga0081455_10000517
265 Ga0081455_10001023
266 Ga0081540_1000013
267 Ga0081539_10000026
268 Ga0081539_10001656
269 Ga0070717_10005170
270 Ga0070717_10057477
271 Ga0070717_10090734
272 Ga0070715_10041996
273 Ga0070716_100075408
274 Ga0070712_100031583
275 Ga0097621_100004996
276 Ga0097621_100124322
277 Ga0075436_100004277
278 Ga0075436_100039901
279 Ga0075436_100061192
280 Ga0105240_10099103
281 Ga0105245_10183097
282 Ga0105245_10392660
283 Ga0114129_10020312
284 Ga0157371_10124265
285 Ga0157374_10020906
286 Ga0157374_10043838
287 Ga0157374_10053293
288 Ga0157374_10091641
289 Ga0157378_10031561
290 Ga0157378_10187839
291 Ga0163162_10060847
292 Ga0163162_10174451
293 Ga0157372_10040049
294 Ga0157372_10400145
295 Ga0157375_10009032
296 Ga0157379_10258970
297 Ga0157376_10010764
298 Ga0157376_10023835
299 Ga0163161_10019429
300 Ga0207697_10000232
301 Ga0207697_10001181
302 Ga0207697_10002693
303 Ga0207697_10010151
304 Ga0207682_10059903
305 Ga0207688_10000273
306 Ga0207688_10011830
307 Ga0207680_10028857
308 Ga0207680_10052796
309 Ga0207647_10081044
310 Ga0207645_10003341
311 Ga0207645_10174268
312 Ga0207684_10000042
313 Ga0207684_10024134
314 Ga0207684_10082017
315 Ga0207693_10015542
316 Ga0207693_10040816
317 Ga0207663_10007213
318 Ga0207646_10000590
319 Ga0207646_10002727
320 Ga0207646_10011566
321 Ga0207646_10051848
322 Ga0207646_10072236
323 Ga0207646_10278028
324 Ga0207650_10044854
325 Ga0207659_10088296
326 Ga0207700_10150297
327 Ga0207700_10205678
328 Ga0207644_10011290
329 Ga0207644_10126501
330 Ga0207706_10054210
331 Ga0207669_10011053
332 Ga0207665_10083278
333 Ga0207691_10004227
334 Ga0207691_10021894
335 Ga0207651_10094298
336 Ga0207651_10126592
337 Ga0207668_10135819
338 Ga0207677_10116330
339 Ga0207641_10174604
340 Ga0207683_10004690
341 Ga0207683_10062290
342 Ga0207683_10090066
343 Ga0268266_10011451
344 Ga0373943_0022374
345 Ga0373931_0112046
346 Ga0373935_0117311
347 Ga0373947_0007298
348 Ga0373937_0062337
349 Ga0395901_0002989
350 Ga0395901_0292903
351 Ga0436363_0766707
352 Ga0451807_0621926
353 Ga0495651_0010540
354 Ga0495598_0041103
355 Ga0495645_0088373
356 Ga0495658_0088656
357 Ga0496102_0007535
358 Ga0496102_0343356
359 Ga0496103_0014508
360 Ga0496104_0093715
361 Ga0496104_0269566
362 Ga0496106_0160527
363 Ga0496107_0009484
364 Ga0496109_0145122
365 Ga0496112_0010614
366 Ga0496112_0176981
367 Ga0496113_0148765
368 Ga0496114_0309118
369 Ga0496115_0014169
370 Ga0501036_0010307
371 Ga0501039_0002219
372 Ga0501039_0149999
373 Ga0501040_0009390
374 Ga0501041_0003467
375 Ga0501042_0012831
376 Ga0501043_0157399
377 Ga0501046_0005038
378 Ga0501069_0123721
379 Ga0501071_0004883
380 Ga0501072_0009389
381 Ga0501074_0008120
382 Ga0501075_0016629
383 Ga0501079_0011995
384 Ga0501080_0018413
385 Ga0501081_0221335
386 Ga0501083_0153573
387 Ga0501045_0010178
388 nmdc:mga05p37_20633_c1
389 nmdc:mga08x19_75676_c1
390 nmdc:mga08x19_9831_c1
391 Ga0501084_0016222
392 Ga0530510_0107555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

280

427

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypv-assembly1.cif.gz_B crystal structure of ore-st-f 0.8383 62 129
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8226 62 129
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8218 62 129
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8216 62 129
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8192 62 129
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9223 14 381 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9151 14 381 3.40.630.30
af_Q54DW0_8_153_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7795 219 368 3.40.630.30
af_Q54LZ9_6_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7753 205 368 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.77 206 370 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W1BAJ8-F1-model_v4 N-acetyltransferase 0.9893 9 133 GO:0016740
AF-A0A7Y2P4C8-F1-model_v4 GNAT family N-acetyltransferase 0.9883 9 133
AF-A0A7X7PJP6-F1-model_v4 N-acetyltransferase 0.9853 17 125 GO:0016740
AF-A0A0P0M1D6-F1-model_v4 N-acetyltransferase 0.9812 9 128
AF-A0A2V6MXT6-F1-model_v4 N-acetyltransferase 0.9796 9 382 GO:0016747

Map