F301145

General Info

Members Datasets Scaffolds Average Seq Length
196 90 165 296

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100049229|Ga0070714_1000492294
Length 305
Sequence MTGASEIGRLLTAMLTPFKENGDVDYDGAQRLATLLTENGSDGVVVFGTTGEAPSLSDEEKIELLKAVKQALPGHTVMAGTGTNDTRHSQAMTHRAVEAGADAILAVVPYYNKPPQEGMYRHFKAIAESASGRPVVMYNIQGRTGVNMTAATTIRCAEIPNIAGVKEASGDIDQMSLVCAGKPDGFRVWSGDDSFTLPLLAVGGYGVICVVSHIAGPAMKALIEAFVEGETEKARQIHGRLVPVIKALMTTASNPIPIKQVVNELGFPAGPFRLPLAPLPDADLERLMGVVREAGELISLPVRVG

Samples

Sample ID Description Type Environment
1 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
2 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
3 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
4 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
5 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
6 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
7 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
8 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
9 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
10 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
11 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
12 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
13 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
14 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
15 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
16 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
17 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
18 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
19 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
20 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
21 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
22 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
23 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
24 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
25 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
26 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
27 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
28 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
76 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
77 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
78 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
79 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
88 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
89 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
90 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0.51
Isolates 15.82

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 0.51
Rhizosphere 80.1
Stem 0
Stem Tuber 0
Unclassified 14.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1005513 3300003578 Bacteria 5440
2 Ga0055538_1000061 3300003751 Bacteria 108045
3 Ga0055541_1000597 3300003841 Bacteria 9667
4 Ga0070703_10000996 3300005406 Bacteria 8912
5 Ga0070703_10001980 3300005406 Bacteria 6000
6 Ga0070714_100005575 3300005435 Bacteria 9615
7 Ga0070714_100046997 3300005435 Bacteria 3664
8 Ga0070714_100049229 3300005435 Bacteria 3587
9 Ga0070714_100055991 3300005435 Bacteria 3372
10 Ga0070714_100111866 3300005435 Bacteria 2419
11 Ga0070713_100031556 3300005436 Bacteria 4221
12 Ga0070705_100009179 3300005440 Bacteria 4910
13 Ga0070705_100043316 3300005440 Bacteria 2578
14 Ga0070708_100000018 3300005445 Bacteria 119022
15 Ga0070708_100007230 3300005445 Bacteria 8872
16 Ga0070708_100033421 3300005445 Bacteria 4468
17 Ga0070708_100069608 3300005445 Bacteria 3165
18 Ga0070708_100097071 3300005445 Bacteria 2693
19 Ga0070708_100146383 3300005445 Bacteria 2194
20 Ga0070708_100513956 3300005445 Bacteria 1130
21 Ga0070706_100000026 3300005467 Bacteria 156154
22 Ga0070706_100000118 3300005467 Bacteria 97396
23 Ga0070706_100000606 3300005467 Bacteria 41522
24 Ga0070706_100000697 3300005467 Bacteria 38037
25 Ga0070706_100017369 3300005467 Bacteria 6638
26 Ga0070706_100021690 3300005467 Bacteria 5916
27 Ga0070706_100087693 3300005467 Bacteria 2885
28 Ga0070706_100205654 3300005467 Bacteria 1838
29 Ga0070706_100343031 3300005467 Bacteria 1393
30 Ga0070706_100621053 3300005467 Bacteria 1004
31 Ga0070707_100000004 3300005468 Bacteria 265003
32 Ga0070707_100004785 3300005468 Bacteria 12670
33 Ga0070707_100006030 3300005468 Bacteria 11312
34 Ga0070707_100008320 3300005468 Bacteria 9629
35 Ga0070707_100010047 3300005468 Bacteria 8809
36 Ga0070707_100011695 3300005468 Bacteria 8189
37 Ga0070707_100022901 3300005468 Bacteria 5906
38 Ga0070707_100031917 3300005468 Bacteria 5017
39 Ga0070707_100111944 3300005468 Bacteria 2648
40 Ga0070707_100123870 3300005468 Bacteria 2510
41 Ga0070698_100008227 3300005471 Bacteria 11283
42 Ga0070698_100008500 3300005471 Bacteria 11082
43 Ga0070698_100011424 3300005471 Bacteria 9420
44 Ga0070698_100016806 3300005471 Bacteria 7718
45 Ga0070698_100021153 3300005471 Bacteria 6816
46 Ga0070698_100023750 3300005471 Bacteria 6405
47 Ga0070698_100030725 3300005471 Bacteria 5569
48 Ga0070698_100066515 3300005471 Bacteria 3627
49 Ga0070698_100152038 3300005471 Bacteria 2262
50 Ga0070698_100296248 3300005471 Bacteria 1548
51 Ga0070698_100318212 3300005471 Bacteria 1486
52 Ga0070699_100000006 3300005518 Bacteria 363492
53 Ga0070699_100000042 3300005518 Bacteria 127464
54 Ga0070699_100000267 3300005518 Bacteria 50075
55 Ga0070699_100000907 3300005518 Bacteria 27639
56 Ga0070699_100029102 3300005518 Bacteria 4763
57 Ga0070699_100038099 3300005518 Bacteria 4163
58 Ga0070699_100075144 3300005518 Bacteria 2941
59 Ga0070699_100205385 3300005518 Bacteria 1752
60 Ga0070697_100000025 3300005536 Bacteria 128895
61 Ga0070697_100000446 3300005536 Bacteria 31743
62 Ga0070697_100008661 3300005536 Bacteria 7943
63 Ga0070697_100037301 3300005536 Bacteria 3927
64 Ga0070697_100100199 3300005536 Bacteria 2406
65 Ga0070697_100147758 3300005536 Bacteria 1980
66 Ga0070697_100157478 3300005536 Bacteria 1918
67 Ga0070697_100242943 3300005536 Bacteria 1538
68 Ga0070695_100006810 3300005545 Bacteria 6766
69 Ga0070695_100031772 3300005545 Bacteria 3296
70 Ga0070695_100098485 3300005545 Bacteria 1965
71 Ga0070717_10000368 3300006028 Bacteria 28942
72 Ga0070717_10001276 3300006028 Bacteria 17232
73 Ga0070717_10002713 3300006028 Bacteria 12487
74 Ga0070717_10006427 3300006028 Bacteria 8645
75 Ga0075365_10025243 3300006038 Bacteria 3760
76 Ga0070716_100240428 3300006173 Bacteria 1227
77 Ga0075433_10008217 3300006852 Bacteria 8315
78 Ga0075434_100015255 3300006871 Bacteria 7364
79 Ga0075434_100038087 3300006871 Bacteria 4763
80 Ga0075436_100004324 3300006914 Bacteria 9747
81 Ga0075436_100015406 3300006914 Bacteria 5236
82 Ga0075436_100031774 3300006914 Bacteria 3637
83 Ga0075436_100039449 3300006914 Bacteria 3259
84 Ga0075436_100043820 3300006914 Bacteria 3085
85 Ga0075436_100052433 3300006914 Bacteria 2816
86 Ga0075435_100012270 3300007076 Bacteria 6337
87 Ga0075435_100246407 3300007076 Bacteria 1520
88 Ga0099794_10001067 3300007265 Bacteria 9371
89 Ga0099794_10006378 3300007265 Bacteria 4773
90 Ga0099794_10034957 3300007265 Bacteria 2370
91 Ga0105241_10411043 3300009174 Bacteria 1189
92 Ga0099796_10052938 3300010159 Bacteria 1415
93 Ga0105239_10926263 3300010375 Bacteria 1000
94 Ga0209784_100037 3300025224 Bacteria 259956
95 Ga0209566_100076 3300025225 Bacteria 161921
96 Ga0209676_1019599 3300025292 Bacteria 2324
97 Ga0209025_1008347 3300025294 Bacteria 7463
98 Ga0207653_10008502 3300025885 Bacteria 3198
99 Ga0207653_10016214 3300025885 Bacteria 2340
100 Ga0207684_10000005 3300025910 Bacteria 736617
101 Ga0207684_10000014 3300025910 Bacteria 440027
102 Ga0207684_10000027 3300025910 Bacteria 313272
103 Ga0207684_10000034 3300025910 Bacteria 291009
104 Ga0207684_10000155 3300025910 Bacteria 117183
105 Ga0207684_10000226 3300025910 Bacteria 86932
106 Ga0207684_10028543 3300025910 Bacteria 4754
107 Ga0207684_10058023 3300025910 Bacteria 3285
108 Ga0207684_10362212 3300025910 Bacteria 1248
109 Ga0207646_10000018 3300025922 Bacteria 291009
110 Ga0207646_10000120 3300025922 Bacteria 106913
111 Ga0207646_10000532 3300025922 Bacteria 50856
112 Ga0207646_10002495 3300025922 Bacteria 21738
113 Ga0207646_10003644 3300025922 Bacteria 17225
114 Ga0207646_10005694 3300025922 Bacteria 13068
115 Ga0207646_10006224 3300025922 Bacteria 12404
116 Ga0207646_10009066 3300025922 Bacteria 9881
117 Ga0207646_10014740 3300025922 Bacteria 7406
118 Ga0207646_10030906 3300025922 Bacteria 4851
119 Ga0207646_10131742 3300025922 Bacteria 2250
120 Ga0207646_10210820 3300025922 Bacteria 1754
121 Ga0207700_10197949 3300025928 Bacteria 1692
122 Ga0207664_10000134 3300025929 Bacteria 63580
123 Ga0207664_10103288 3300025929 Bacteria 2358
124 Ga0207664_10104953 3300025929 Bacteria 2341
125 Ga0207664_10118881 3300025929 Bacteria 2209
126 Ga0207665_10059622 3300025939 Bacteria 2583
127 Ga0209588_1000060 3300027671 Bacteria 38786
128 Ga0209588_1018846 3300027671 Bacteria 2150
129 Ga0307513_10001719 3300031456 Bacteria 31238
130 Ga0316579_10012475 3300031691 Bacteria 3637
131 Ga0265314_10019599 3300031711 Bacteria 5238
132 Ga0307412_10133550 3300031911 Bacteria 1807
133 Ga0373947_0009698 3300035725 Bacteria 5525
134 Ga0439439_0014096 3300041406 Bacteria 1943
135 Ga0439449_0000299 3300042007 Bacteria 17855
136 Ga0453683_0064832 3300044673 Unclassified 2284
137 Ga0466959_0253967 3300045049 Bacteria 1212
138 Ga0496108_0126681 3300048911 Bacteria 2193
139 Ga0496116_0003311 3300048919 Bacteria 16017
140 Ga0496116_0033415 3300048919 Bacteria 3650
141 Ga0496116_0140678 3300048919 Bacteria 1358
142 Ga0496117_0017439 3300048920 Bacteria 5994
143 Ga0496118_0056074 3300048921 Bacteria 2965
144 Ga0496119_0004857 3300048922 Bacteria 13166
145 Ga0496119_0117557 3300048922 Unclassified 1466
146 Ga0496121_0190365 3300048924 Bacteria 1471
147 Ga0496122_0006675 3300048925 Bacteria 13146
148 Ga0496122_0014024 3300048925 Bacteria 7783
149 Ga0496122_0051673 3300048925 Bacteria 3120
150 Ga0496123_0056439 3300048926 Bacteria 2566
151 Ga0496123_0179564 3300048926 Bacteria 1107
152 Ga0496124_0007997 3300048927 Bacteria 11127
153 Ga0496124_0029984 3300048927 Bacteria 4837
154 Ga0496125_0000339 3300048928 Bacteria 89561
155 Ga0496125_0001590 3300048928 Bacteria 32164
156 Ga0496126_0006294 3300048929 Bacteria 13255
157 nmdc:mga0n895_14461_c1 3300050512 Bacteria 7169
158 nmdc:mga0n895_152184_c1 3300050512 Bacteria 2344
159 nmdc:mga0rr50_15611_c1 3300050513 Bacteria 5018
160 nmdc:mga08x19_17476_c1 3300050514 Bacteria 4388
161 nmdc:mga08x19_18176_c1 3300050514 Bacteria 4307
162 nmdc:mga08x19_19713_c1 3300050514 Bacteria 4143
163 nmdc:mga08x19_53958_c1 3300050514 Bacteria 2587
164 nmdc:mga08x19_65217_c1 3300050514 Bacteria 2365
165 nmdc:mga08x19_79343_c1 3300050514 Bacteria 2153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100069608 Ga0070708_1000696082 257
2 3300005467 Ga0070706_100000118 Ga0070706_10000011814 257
3 3300005468 Ga0070707_100006030 Ga0070707_10000603010 257
4 3300005471 Ga0070698_100023750 Ga0070698_1000237506 257
5 3300006028 Ga0070717_10002713 Ga0070717_100027136 257
6 3300025910 Ga0207684_10000155 Ga0207684_10000155111 257
7 3300025922 Ga0207646_10002495 Ga0207646_100024958 257
8 3300003751 Ga0055538_1000061 Ga0055538_100006122 268
9 3300025224 Ga0209784_100037 Ga0209784_100037167 268
10 3300005406 Ga0070703_10001980 Ga0070703_100019806 276
11 3300005468 Ga0070707_100011695 Ga0070707_1000116957 276
12 3300005468 Ga0070707_100111944 Ga0070707_1001119442 276
13 3300005471 Ga0070698_100008227 Ga0070698_1000082276 276
14 3300005471 Ga0070698_100066515 Ga0070698_1000665153 276
15 3300005518 Ga0070699_100029102 Ga0070699_1000291024 276
16 3300005518 Ga0070699_100205385 Ga0070699_1002053852 276
17 3300005536 Ga0070697_100147758 Ga0070697_1001477582 276
18 3300010375 Ga0105239_10926263 Ga0105239_109262631 276
19 3300025885 Ga0207653_10008502 Ga0207653_100085023 276
20 3300025910 Ga0207684_10000226 Ga0207684_1000022642 276
21 3300025922 Ga0207646_10000532 Ga0207646_1000053227 276
22 3300025922 Ga0207646_10030906 Ga0207646_100309064 276
23 3300025922 Ga0207646_10210820 Ga0207646_102108202 276
24 3300035725 Ga0373947_0009698 Ga0373947_0009698_3184_4062 276
25 3300050512 nmdc:mga0n895_14461_c1 nmdc:mga0n895_14461_c1_2144_3022 276
26 3300050513 nmdc:mga0rr50_15611_c1 nmdc:mga0rr50_15611_c1_1230_2108 276
27 3300050514 nmdc:mga08x19_19713_c1 nmdc:mga08x19_19713_c1_493_1371 276
28 3300050514 nmdc:mga08x19_53958_c1 nmdc:mga08x19_53958_c1_1534_2412 276
29 3300007265 Ga0099794_10001067 Ga0099794_100010672 278
30 iso_pu_bacteria 2576861424 2578337428 278
31 3300041406 Ga0439439_0014096 Ga0439439_0014096_541_1401 281
32 3300042007 Ga0439449_0000299 Ga0439449_0000299_7045_7905 281
33 iso_pu_bacteria 2791355222 2793183023 283
34 iso_pu_bacteria 8057733483 8057737924 284
35 3300005435 Ga0070714_100055991 Ga0070714_1000559913 285
36 3300005518 Ga0070699_100075144 Ga0070699_1000751443 285
37 3300005536 Ga0070697_100000446 Ga0070697_1000004464 285
38 3300005545 Ga0070695_100098485 Ga0070695_1000984852 285
39 3300006852 Ga0075433_10008217 Ga0075433_100082177 285
40 3300006871 Ga0075434_100015255 Ga0075434_1000152555 285
41 3300006914 Ga0075436_100004324 Ga0075436_1000043243 285
42 3300006914 Ga0075436_100043820 Ga0075436_1000438203 285
43 3300006914 Ga0075436_100052433 Ga0075436_1000524333 285
44 3300007076 Ga0075435_100012270 Ga0075435_1000122703 285
45 3300050512 nmdc:mga0n895_152184_c1 nmdc:mga0n895_152184_c1_596_1504 285
46 3300050514 nmdc:mga08x19_17476_c1 nmdc:mga08x19_17476_c1_3014_3919 285
47 3300005406 Ga0070703_10000996 Ga0070703_100009968 286
48 3300005435 Ga0070714_100046997 Ga0070714_1000469971 286
49 3300005435 Ga0070714_100111866 Ga0070714_1001118662 286
50 3300005436 Ga0070713_100031556 Ga0070713_1000315562 286
51 3300005440 Ga0070705_100009179 Ga0070705_1000091796 286
52 3300005440 Ga0070705_100043316 Ga0070705_1000433163 286
53 3300005445 Ga0070708_100000018 Ga0070708_10000001831 286
54 3300005445 Ga0070708_100007230 Ga0070708_1000072305 286
55 3300005445 Ga0070708_100097071 Ga0070708_1000970713 286
56 3300005445 Ga0070708_100146383 Ga0070708_1001463833 286
57 3300005445 Ga0070708_100513956 Ga0070708_1005139562 286
58 3300005467 Ga0070706_100000026 Ga0070706_10000002661 286
59 3300005467 Ga0070706_100000606 Ga0070706_10000060635 286
60 3300005467 Ga0070706_100000697 Ga0070706_10000069710 286
61 3300005467 Ga0070706_100017369 Ga0070706_1000173694 286
62 3300005467 Ga0070706_100021690 Ga0070706_1000216903 286
63 3300005467 Ga0070706_100205654 Ga0070706_1002056542 286
64 3300005467 Ga0070706_100343031 Ga0070706_1003430312 286
65 3300005468 Ga0070707_100000004 Ga0070707_10000000432 286
66 3300005468 Ga0070707_100004785 Ga0070707_1000047855 286
67 3300005468 Ga0070707_100008320 Ga0070707_1000083209 286
68 3300005468 Ga0070707_100010047 Ga0070707_1000100477 286
69 3300005468 Ga0070707_100022901 Ga0070707_1000229016 286
70 3300005468 Ga0070707_100031917 Ga0070707_1000319175 286
71 3300005468 Ga0070707_100123870 Ga0070707_1001238703 286
72 3300005471 Ga0070698_100011424 Ga0070698_1000114246 286
73 3300005471 Ga0070698_100016806 Ga0070698_1000168065 286
74 3300005471 Ga0070698_100021153 Ga0070698_1000211535 286
75 3300005471 Ga0070698_100030725 Ga0070698_1000307253 286
76 3300005471 Ga0070698_100296248 Ga0070698_1002962482 286
77 3300005471 Ga0070698_100318212 Ga0070698_1003182122 286
78 3300005518 Ga0070699_100000006 Ga0070699_100000006113 286
79 3300005518 Ga0070699_100000042 Ga0070699_10000004276 286
80 3300005518 Ga0070699_100000267 Ga0070699_1000002677 286
81 3300005518 Ga0070699_100000907 Ga0070699_10000090719 286
82 3300005518 Ga0070699_100038099 Ga0070699_1000380992 286
83 3300005536 Ga0070697_100000025 Ga0070697_10000002559 286
84 3300005536 Ga0070697_100008661 Ga0070697_1000086611 286
85 3300005536 Ga0070697_100037301 Ga0070697_1000373011 286
86 3300005536 Ga0070697_100100199 Ga0070697_1001001992 286
87 3300005536 Ga0070697_100242943 Ga0070697_1002429432 286
88 3300005545 Ga0070695_100006810 Ga0070695_1000068103 286
89 3300005545 Ga0070695_100031772 Ga0070695_1000317722 286
90 3300006028 Ga0070717_10000368 Ga0070717_1000036816 286
91 3300006028 Ga0070717_10001276 Ga0070717_1000127613 286
92 3300006028 Ga0070717_10006427 Ga0070717_100064276 286
93 3300006173 Ga0070716_100240428 Ga0070716_1002404282 286
94 3300006871 Ga0075434_100038087 Ga0075434_1000380873 286
95 3300006914 Ga0075436_100015406 Ga0075436_1000154063 286
96 3300006914 Ga0075436_100031774 Ga0075436_1000317742 286
97 3300006914 Ga0075436_100039449 Ga0075436_1000394492 286
98 3300007076 Ga0075435_100246407 Ga0075435_1002464072 286
99 3300007265 Ga0099794_10006378 Ga0099794_100063781 286
100 3300007265 Ga0099794_10034957 Ga0099794_100349573 286
101 3300009174 Ga0105241_10411043 Ga0105241_104110432 286
102 3300010159 Ga0099796_10052938 Ga0099796_100529381 286
103 3300025885 Ga0207653_10016214 Ga0207653_100162143 286
104 3300025910 Ga0207684_10000005 Ga0207684_10000005169 286
105 3300025910 Ga0207684_10000014 Ga0207684_10000014170 286
106 3300025910 Ga0207684_10000027 Ga0207684_10000027295 286
107 3300025910 Ga0207684_10000034 Ga0207684_1000003462 286
108 3300025910 Ga0207684_10028543 Ga0207684_100285435 286
109 3300025910 Ga0207684_10362212 Ga0207684_103622122 286
110 3300025922 Ga0207646_10000018 Ga0207646_1000001862 286
111 3300025922 Ga0207646_10000120 Ga0207646_1000012081 286
112 3300025922 Ga0207646_10003644 Ga0207646_100036445 286
113 3300025922 Ga0207646_10005694 Ga0207646_100056948 286
114 3300025922 Ga0207646_10006224 Ga0207646_100062245 286
115 3300025922 Ga0207646_10009066 Ga0207646_100090665 286
116 3300025922 Ga0207646_10014740 Ga0207646_100147407 286
117 3300025922 Ga0207646_10131742 Ga0207646_101317421 286
118 3300025928 Ga0207700_10197949 Ga0207700_101979492 286
119 3300025929 Ga0207664_10104953 Ga0207664_101049532 286
120 3300025929 Ga0207664_10118881 Ga0207664_101188812 286
121 3300025939 Ga0207665_10059622 Ga0207665_100596222 286
122 3300027671 Ga0209588_1000060 Ga0209588_10000603 286
123 3300031456 Ga0307513_10001719 Ga0307513_100017198 286
124 3300031691 Ga0316579_10012475 Ga0316579_100124752 286
125 3300050514 nmdc:mga08x19_18176_c1 nmdc:mga08x19_18176_c1_67_975 286
126 3300050514 nmdc:mga08x19_65217_c1 nmdc:mga08x19_65217_c1_699_1610 286
127 3300050514 nmdc:mga08x19_79343_c1 nmdc:mga08x19_79343_c1_1142_2050 286
128 iso_pu_bacteria 2938649242 2938652164 286
129 iso_pu_bacteria 2968558590 2968561500 286
130 iso_pu_bacteria 2996632988 2996638597 286
131 3300048919 Ga0496116_0003311 Ga0496116_0003311_9262_10125 287
132 3300048922 Ga0496119_0117557 Ga0496119_0117557_130_993 287
133 3300048925 Ga0496122_0014024 Ga0496122_0014024_184_1047 287
134 3300048926 Ga0496123_0056439 Ga0496123_0056439_1567_2430 287
135 3300048927 Ga0496124_0007997 Ga0496124_0007997_6805_7668 287
136 3300048928 Ga0496125_0001590 Ga0496125_0001590_15876_16739 287
137 iso_pu_bacteria 2548877040 2550904297 287
138 iso_pu_bacteria 2571042143 2571528758 287
139 iso_pu_bacteria 2571042588 2573038305 287
140 iso_pu_bacteria 2579778775 2580933607 287
141 iso_pu_bacteria 2619619294 2621275755 287
142 iso_pu_bacteria 2728368933 2728531599 287
143 iso_pu_bacteria 2881636855 2881637229 287
144 iso_pu_bacteria 2885526491 2885526890 287
145 iso_pu_bacteria 2904162308 2904165415 287
146 iso_pu_bacteria 2971511577 2971511895 287
147 iso_pu_bacteria 2980176882 2980177035 287
148 iso_pu_bacteria 2988225383 2988226570 287
149 iso_pu_bacteria 8054465665 8054469041 287
150 3300003841 Ga0055541_1000597 Ga0055541_10005975 288
151 3300005435 Ga0070714_100005575 Ga0070714_1000055759 288
152 3300005435 Ga0070714_100049229 Ga0070714_1000492294 288
153 3300005445 Ga0070708_100033421 Ga0070708_1000334214 288
154 3300005467 Ga0070706_100087693 Ga0070706_1000876933 288
155 3300005467 Ga0070706_100621053 Ga0070706_1006210531 288
156 3300005471 Ga0070698_100008500 Ga0070698_1000085009 288
157 3300005471 Ga0070698_100152038 Ga0070698_1001520382 288
158 3300005536 Ga0070697_100157478 Ga0070697_1001574781 288
159 3300006038 Ga0075365_10025243 Ga0075365_100252432 288
160 3300025225 Ga0209566_100076 Ga0209566_10007683 288
161 3300025292 Ga0209676_1019599 Ga0209676_10195992 288
162 3300025294 Ga0209025_1008347 Ga0209025_10083474 288
163 3300025910 Ga0207684_10058023 Ga0207684_100580232 288
164 3300025929 Ga0207664_10000134 Ga0207664_1000013456 288
165 3300025929 Ga0207664_10103288 Ga0207664_101032883 288
166 3300027671 Ga0209588_1018846 Ga0209588_10188462 288
167 3300031711 Ga0265314_10019599 Ga0265314_100195992 288
168 3300031911 Ga0307412_10133550 Ga0307412_101335502 288
169 3300044673 Ga0453683_0064832 Ga0453683_0064832_365_1252 288
170 3300045049 Ga0466959_0253967 Ga0466959_0253967_217_1131 288
171 3300048911 Ga0496108_0126681 Ga0496108_0126681_832_1734 288
172 iso_pu_bacteria 2821111986 2821113521 288
173 iso_pu_bacteria 2904595352 2904596816 288
174 iso_pu_bacteria 2984527788 2984529034 288
175 iso_pu_bacteria 2984532647 2984535136 288
176 iso_pu_bacteria 2721755693 2723603562 289
177 iso_pu_bacteria 2728369359 2730139557 289
178 iso_pu_bacteria 2802428803 2802435920 289
179 iso_pu_bacteria 2889276214 2889279487 289
180 iso_pu_bacteria 2939702853 2939703546 289
181 iso_pu_bacteria 2996706504 2996707472 289
182 iso_pu_bacteria 648028048 648169871 289
183 3300003578 Ga0006562J51391_1005513 Ga0006562J51391_10055133 293
184 3300048919 Ga0496116_0033415 Ga0496116_0033415_2496_3377 293
185 3300048919 Ga0496116_0140678 Ga0496116_0140678_344_1234 293
186 3300048920 Ga0496117_0017439 Ga0496117_0017439_2199_3080 293
187 3300048921 Ga0496118_0056074 Ga0496118_0056074_1541_2422 293
188 3300048922 Ga0496119_0004857 Ga0496119_0004857_6117_6998 293
189 3300048924 Ga0496121_0190365 Ga0496121_0190365_161_1042 293
190 3300048925 Ga0496122_0006675 Ga0496122_0006675_10598_11479 293
191 3300048925 Ga0496122_0051673 Ga0496122_0051673_1493_2389 293
192 3300048926 Ga0496123_0179564 Ga0496123_0179564_103_999 293
193 3300048927 Ga0496124_0029984 Ga0496124_0029984_3836_4717 293
194 3300048928 Ga0496125_0000339 Ga0496125_0000339_47932_48813 293
195 3300048929 Ga0496126_0006294 Ga0496126_0006294_1221_2102 293
196 iso_pu_bacteria 2751185905 2753808128 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

6

294

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ktl-assembly1.cif.gz_A dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. 0.98 3 292
3hij-assembly1.cif.gz_D crystal structure of dihydrodipicolinate synthase from bacillus anthracis in complex with its substrate, pyruvate 0.9786 1 292
1xl9-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase dapa-2 (ba3935) from bacillus anthracis. 0.9777 1 292
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9727 1 292
5j5d-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid 0.9724 4 292
ID Description Score Start End Superfamily
1xl9D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9722 1 292 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9675 6 292 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9659 4 292 3.20.20.70
4fhaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9653 6 292 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9649 4 292 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A538AT60-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9845 3 292 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A537YFE7-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9825 11 292 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A0U1NY71-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9802 2 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A1V5J460-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9789 6 292 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A520J362-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9781 3 140 GO:0005829
GO:0008840

Feature Viewer

pLDDT pTM Quality
94.61 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map