F301130

General Info

Members Datasets Scaffolds Average Seq Length
196 147 392 186

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100207453|Ga0070659_1002074532
Length 212
Sequence MRCREWARAWRTRKSSGGAGKTRRYGAGIADCGVSKELQEIDSEMRAWIAAQRMFFVATAPLAADGHVNVSPKGGDTFRLLGPTEAVYQDYTGSGAESAAHVRENGRMVIMFCAFEGPPKIVRLHGQGTVIDSGDPPFEDLAALFPPHPGTRAFVHLRVKRVSSSCGYAVPMYDFREERDTLTKWTAKKTPEELAEYRVRKNRRSIDGLPAF

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
27 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
49 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
50 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
51 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
58 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
139 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
140 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
141 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
142 2808606394 Promicromonospora sp. C35 Isolate Unclassified
143 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
144 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
145 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
146 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
147 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.41
Metatranscriptomes 0
Isolates 4.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 5.61
Rhizosphere 88.78
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100207453 3300005366 Bacteria 1614
2 JGI25152J39213_1000238 3300002773 Bacteria 36981
3 Ga0070658_10458514 3300005327 Bacteria 1099
4 Ga0070658_10728359 3300005327 Bacteria 861
5 Ga0068868_100339989 3300005338 Bacteria 1283
6 Ga0070688_100857425 3300005365 Bacteria 714
7 Ga0070709_10138465 3300005434 Bacteria 1670
8 Ga0070685_10536260 3300005466 Bacteria 833
9 Ga0070684_100068745 3300005535 Bacteria 3114
10 Ga0070686_100001543 3300005544 Bacteria 12942
11 Ga0070693_100710264 3300005547 Unclassified 737
12 Ga0068857_100344378 3300005577 Bacteria 1379
13 Ga0068863_100219134 3300005841 Unclassified 1833
14 Ga0068863_100456338 3300005841 Bacteria 1255
15 Ga0068858_100174670 3300005842 Bacteria 2027
16 Ga0068860_100603072 3300005843 Bacteria 1103
17 Ga0070716_100073333 3300006173 Bacteria 2019
18 Ga0070712_100198173 3300006175 Bacteria 1576
19 Ga0075367_10086017 3300006178 Bacteria 1908
20 Ga0068871_100388353 3300006358 Bacteria 1241
21 Ga0114129_10329484 3300009147 Bacteria 2028
22 Ga0105248_10021281 3300009177 Bacteria 7187
23 Ga0105248_10249499 3300009177 Bacteria 1998
24 Ga0105248_11418606 3300009177 Unclassified 786
25 Ga0105237_10081620 3300009545 Bacteria 3224
26 Ga0105239_10092232 3300010375 Bacteria 3343
27 Ga0105239_10664144 3300010375 Bacteria 1191
28 Ga0157369_10069806 3300013105 Bacteria 3774
29 Ga0157372_10025466 3300013307 Bacteria 6433
30 Ga0163163_10028131 3300014325 Bacteria 5394
31 Ga0213871_10024023 3300021441 Bacteria 1540
32 Ga0209129_1000067 3300025258 Bacteria 219974
33 Ga0209025_1000226 3300025294 Bacteria 132801
34 Ga0207647_10035779 3300025904 Bacteria 3161
35 Ga0207645_10327097 3300025907 Bacteria 1023
36 Ga0207705_10730968 3300025909 Bacteria 769
37 Ga0207700_10086767 3300025928 Bacteria 2460
38 Ga0207711_10062480 3300025941 Bacteria 3212
39 Ga0207712_11015007 3300025961 Unclassified 736
40 Ga0207641_10149364 3300026088 Bacteria 2115
41 Ga0207641_10420029 3300026088 Unclassified 1287
42 Ga0207676_10020549 3300026095 Bacteria 4832
43 Ga0207674_10437000 3300026116 Bacteria 1265
44 Ga0207674_11521528 3300026116 Unclassified 638
45 Ga0268264_10507013 3300028381 Bacteria 1178
46 Ga0265338_10019844 3300028800 Bacteria 7104
47 Ga0316176_1207136 3300030732 Bacteria 1460
48 Ga0265327_10017549 3300031251 Bacteria 4483
49 Ga0307408_100169325 3300031548 Bacteria 1743
50 Ga0307413_10075741 3300031824 Bacteria 2137
51 Ga0307413_10241201 3300031824 Bacteria 1335
52 Ga0307413_10262067 3300031824 Bacteria 1289
53 Ga0307407_10177442 3300031903 Bacteria 1409
54 Ga0307407_10261385 3300031903 Bacteria 1191
55 Ga0307412_10123471 3300031911 Bacteria 1868
56 Ga0307409_100057818 3300031995 Bacteria 3008
57 Ga0307411_10315700 3300032005 Bacteria 1260
58 Ga0373923_0066882 3300035111 Bacteria 1536
59 Ga0373923_0240082 3300035111 Bacteria 846
60 Ga0373954_0000927 3300035118 Bacteria 11403
61 Ga0373954_0038123 3300035118 Bacteria 2234
62 Ga0373955_0249956 3300035172 Bacteria 1063
63 Ga0373924_0021496 3300035410 Bacteria 2517
64 Ga0373927_0540772 3300035695 Bacteria 770
65 Ga0373937_0003191 3300036401 Bacteria 13729
66 Ga0373937_0027716 3300036401 Bacteria 5125
67 Ga0373937_0042984 3300036401 Bacteria 4124
68 Ga0395900_0039423 3300037418 Unclassified 4867
69 Ga0395905_0001603 3300037471 Bacteria 26891
70 Ga0395901_0429916 3300038443 Unclassified 1353
71 Ga0439431_0020294 3300041997 Bacteria 1586
72 Ga0439442_000264 3300042002 Bacteria 12762
73 Ga0451577_0001055 3300042876 Bacteria 39728
74 Ga0466972_0186693 3300044658 Bacteria 972
75 Ga0466966_0120065 3300044684 Bacteria 1615
76 Ga0466966_0125860 3300044684 Bacteria 1572
77 Ga0466961_0393922 3300044693 Bacteria 841
78 Ga0466963_0020494 3300044694 Bacteria 4158
79 Ga0466963_0042197 3300044694 Bacteria 2994
80 Ga0466963_0092772 3300044694 Bacteria 2058
81 Ga0466963_0306445 3300044694 Bacteria 1117
82 Ga0466964_0112050 3300044706 Bacteria 1218
83 Ga0466971_0131988 3300044719 Bacteria 1160
84 Ga0466970_0470751 3300044765 Bacteria 722
85 Ga0466957_0162740 3300044842 Bacteria 1450
86 Ga0466957_0342555 3300044842 Bacteria 1013
87 Ga0466959_0020884 3300045049 Bacteria 4826
88 Ga0466959_0072978 3300045049 Bacteria 2483
89 Ga0466958_0015046 3300045836 Bacteria 4426
90 Ga0466967_0002518 3300045976 Bacteria 11459
91 Ga0466967_0008992 3300045976 Bacteria 7380
92 Ga0466967_0032465 3300045976 Bacteria 4409
93 Ga0466967_0105098 3300045976 Bacteria 2586
94 Ga0466967_0252946 3300045976 Bacteria 1683
95 Ga0495627_063774 3300046453 Bacteria 1085
96 Ga0495592_0149730 3300046454 Unclassified 1615
97 Ga0495592_0280551 3300046454 Bacteria 1090
98 Ga0495651_0151479 3300046462 Bacteria 1671
99 Ga0495580_0056033 3300046472 Bacteria 2776
100 Ga0495608_0001698 3300046511 Bacteria 15798
101 Ga0495608_0110580 3300046511 Unclassified 1767
102 Ga0495618_0062427 3300046514 Archaea 2364
103 Ga0495630_0412308 3300046517 Bacteria 1035
104 Ga0495652_0325986 3300046529 Bacteria 1108
105 Ga0495640_0465693 3300046533 Unclassified 771
106 Ga0495587_0008670 3300046536 Bacteria 6531
107 Ga0495587_0162217 3300046536 Bacteria 1272
108 Ga0495587_0233487 3300046536 Unclassified 1036
109 Ga0495667_0041653 3300046559 Bacteria 3045
110 Ga0495667_0275800 3300046559 Bacteria 1068
111 Ga0495634_0048909 3300046642 Bacteria 2845
112 Ga0495635_0042447 3300046663 Archaea 3140
113 Ga0495657_0042103 3300046675 Archaea 3120
114 Ga0495599_0011160 3300046678 Bacteria 5515
115 Ga0495599_0230840 3300046678 Unclassified 1130
116 Ga0495599_0497314 3300046678 Bacteria 718
117 Ga0495613_0167463 3300046689 Bacteria 1561
118 Ga0495613_0414563 3300046689 Unclassified 917
119 Ga0495613_0445170 3300046689 Bacteria 878
120 Ga0495600_0063003 3300046809 Bacteria 2423
121 Ga0495600_0303888 3300046809 Bacteria 1006
122 Ga0495604_0090281 3300047317 Unclassified 2276
123 Ga0495680_0116363 3300047322 Bacteria 1977
124 Ga0495680_0307630 3300047322 Bacteria 1112
125 Ga0495675_0128971 3300047444 Bacteria 1573
126 Ga0495684_0053852 3300047471 Archaea 3069
127 Ga0495684_0173839 3300047471 Bacteria 1600
128 Ga0495684_0382732 3300047471 Unclassified 992
129 Ga0495602_0030785 3300048088 Bacteria 5085
130 Ga0496102_0001153 3300048905 Bacteria 24147
131 Ga0496103_0009198 3300048906 Bacteria 5851
132 Ga0496103_0674123 3300048906 Bacteria 656
133 Ga0496104_0087198 3300048907 Bacteria 2980
134 Ga0496105_0082213 3300048908 Bacteria 2660
135 Ga0496108_0015461 3300048911 Bacteria 6225
136 Ga0496109_0008121 3300048912 Bacteria 8899
137 Ga0496110_0029084 3300048913 Bacteria 4751
138 Ga0496111_0006453 3300048914 Bacteria 7619
139 Ga0496112_0034571 3300048915 Bacteria 4918
140 Ga0496113_0235807 3300048916 Bacteria 1459
141 Ga0496126_0097374 3300048929 Bacteria 2578
142 Ga0501031_0001560 3300049568 Bacteria 14265
143 Ga0501033_0198297 3300049570 Bacteria 1434
144 Ga0501034_0098098 3300049571 Bacteria 2926
145 Ga0501034_0734472 3300049571 Bacteria 883
146 Ga0501036_0140030 3300049572 Bacteria 2041
147 Ga0501036_0403079 3300049572 Bacteria 1141
148 Ga0501037_0030621 3300049573 Bacteria 3975
149 Ga0501038_0003728 3300049574 Bacteria 14198
150 Ga0501039_0019485 3300049575 Bacteria 5202
151 Ga0501039_0376479 3300049575 Bacteria 1115
152 Ga0501040_0101420 3300049576 Bacteria 2008
153 Ga0501041_0073944 3300049577 Bacteria 2094
154 Ga0501042_0070876 3300049578 Bacteria 2493
155 Ga0501043_0024979 3300049579 Bacteria 4688
156 Ga0501048_0035965 3300049582 Bacteria 3562
157 Ga0501048_0110162 3300049582 Bacteria 1944
158 Ga0501067_0028831 3300049583 Bacteria 3077
159 Ga0501068_0273528 3300049584 Bacteria 1078
160 Ga0501070_0372754 3300049586 Bacteria 1157
161 Ga0501071_0249995 3300049587 Bacteria 1338
162 Ga0501072_0082104 3300049588 Bacteria 2555
163 Ga0501073_0098918 3300049589 Bacteria 2025
164 Ga0501074_0041453 3300049590 Bacteria 3333
165 Ga0501074_0305984 3300049590 Bacteria 1129
166 Ga0501075_0126164 3300049591 Bacteria 1948
167 Ga0501076_0086605 3300049592 Bacteria 2518
168 Ga0501076_1143211 3300049592 Bacteria 641
169 Ga0501077_0093590 3300049593 Bacteria 1905
170 Ga0501079_0038755 3300049741 Bacteria 3675
171 Ga0501079_0636579 3300049741 Bacteria 840
172 Ga0501081_0325237 3300049743 Bacteria 1131
173 Ga0501083_0286920 3300049744 Bacteria 1070
174 Ga0501044_0027282 3300049823 Bacteria 6037
175 Ga0501045_0089051 3300049824 Bacteria 2280
176 nmdc:mga05p37_288364_c1 3300050507 Bacteria 1954
177 nmdc:mga0n895_873302_c1 3300050512 Bacteria 886
178 Ga0495595_0043160 3300053084 Bacteria 2067
179 Ga0495619_0038851 3300053085 Bacteria 3106
180 Ga0501084_0104088 3300054114 Bacteria 2384
181 Ga0501084_0112308 3300054114 Bacteria 2290
182 Ga0501084_0323841 3300054114 Bacteria 1302
183 Ga0501084_0651241 3300054114 Bacteria 889
184 Ga0501082_0061660 3300060353 Bacteria 3228
185 Ga0501082_0801598 3300060353 Bacteria 824
186 Ga0466962_0036695 3300061719 Bacteria 2347
187 Ga0530510_0303734 3300061734 Bacteria 1194
188 2739606118 2739367654 Bacteria 6049412
189 2760307223 2758568522 Bacteria 5953541
190 2760624486 2758568621 Bacteria 5967089
191 2809029346 2808606394 Bacteria 6248540
192 2857742868 2857740372 Bacteria 4782044
193 2910809757 2910809715 Bacteria 4982797
194 2932431263 2932431166 Bacteria 4215299
195 8054109289 8054107350 Bacteria 5022511
196 8056583653 8056579771 Bacteria 5840325
197 Ga0070659_100207453
198 JGI25152J39213_1000238
199 Ga0070658_10458514
200 Ga0070658_10728359
201 Ga0068868_100339989
202 Ga0070688_100857425
203 Ga0070709_10138465
204 Ga0070685_10536260
205 Ga0070684_100068745
206 Ga0070686_100001543
207 Ga0070693_100710264
208 Ga0068857_100344378
209 Ga0068863_100219134
210 Ga0068863_100456338
211 Ga0068858_100174670
212 Ga0068860_100603072
213 Ga0070716_100073333
214 Ga0070712_100198173
215 Ga0075367_10086017
216 Ga0068871_100388353
217 Ga0114129_10329484
218 Ga0105248_10021281
219 Ga0105248_10249499
220 Ga0105248_11418606
221 Ga0105237_10081620
222 Ga0105239_10092232
223 Ga0105239_10664144
224 Ga0157369_10069806
225 Ga0157372_10025466
226 Ga0163163_10028131
227 Ga0213871_10024023
228 Ga0209129_1000067
229 Ga0209025_1000226
230 Ga0207647_10035779
231 Ga0207645_10327097
232 Ga0207705_10730968
233 Ga0207700_10086767
234 Ga0207711_10062480
235 Ga0207712_11015007
236 Ga0207641_10149364
237 Ga0207641_10420029
238 Ga0207676_10020549
239 Ga0207674_10437000
240 Ga0207674_11521528
241 Ga0268264_10507013
242 Ga0265338_10019844
243 Ga0316176_1207136
244 Ga0265327_10017549
245 Ga0307408_100169325
246 Ga0307413_10075741
247 Ga0307413_10241201
248 Ga0307413_10262067
249 Ga0307407_10177442
250 Ga0307407_10261385
251 Ga0307412_10123471
252 Ga0307409_100057818
253 Ga0307411_10315700
254 Ga0373923_0066882
255 Ga0373923_0240082
256 Ga0373954_0000927
257 Ga0373954_0038123
258 Ga0373955_0249956
259 Ga0373924_0021496
260 Ga0373927_0540772
261 Ga0373937_0003191
262 Ga0373937_0027716
263 Ga0373937_0042984
264 Ga0395900_0039423
265 Ga0395905_0001603
266 Ga0395901_0429916
267 Ga0439431_0020294
268 Ga0439442_000264
269 Ga0451577_0001055
270 Ga0466972_0186693
271 Ga0466966_0120065
272 Ga0466966_0125860
273 Ga0466961_0393922
274 Ga0466963_0020494
275 Ga0466963_0042197
276 Ga0466963_0092772
277 Ga0466963_0306445
278 Ga0466964_0112050
279 Ga0466971_0131988
280 Ga0466970_0470751
281 Ga0466957_0162740
282 Ga0466957_0342555
283 Ga0466959_0020884
284 Ga0466959_0072978
285 Ga0466958_0015046
286 Ga0466967_0002518
287 Ga0466967_0008992
288 Ga0466967_0032465
289 Ga0466967_0105098
290 Ga0466967_0252946
291 Ga0495627_063774
292 Ga0495592_0149730
293 Ga0495592_0280551
294 Ga0495651_0151479
295 Ga0495580_0056033
296 Ga0495608_0001698
297 Ga0495608_0110580
298 Ga0495618_0062427
299 Ga0495630_0412308
300 Ga0495652_0325986
301 Ga0495640_0465693
302 Ga0495587_0008670
303 Ga0495587_0162217
304 Ga0495587_0233487
305 Ga0495667_0041653
306 Ga0495667_0275800
307 Ga0495634_0048909
308 Ga0495635_0042447
309 Ga0495657_0042103
310 Ga0495599_0011160
311 Ga0495599_0230840
312 Ga0495599_0497314
313 Ga0495613_0167463
314 Ga0495613_0414563
315 Ga0495613_0445170
316 Ga0495600_0063003
317 Ga0495600_0303888
318 Ga0495604_0090281
319 Ga0495680_0116363
320 Ga0495680_0307630
321 Ga0495675_0128971
322 Ga0495684_0053852
323 Ga0495684_0173839
324 Ga0495684_0382732
325 Ga0495602_0030785
326 Ga0496102_0001153
327 Ga0496103_0009198
328 Ga0496103_0674123
329 Ga0496104_0087198
330 Ga0496105_0082213
331 Ga0496108_0015461
332 Ga0496109_0008121
333 Ga0496110_0029084
334 Ga0496111_0006453
335 Ga0496112_0034571
336 Ga0496113_0235807
337 Ga0496126_0097374
338 Ga0501031_0001560
339 Ga0501033_0198297
340 Ga0501034_0098098
341 Ga0501034_0734472
342 Ga0501036_0140030
343 Ga0501036_0403079
344 Ga0501037_0030621
345 Ga0501038_0003728
346 Ga0501039_0019485
347 Ga0501039_0376479
348 Ga0501040_0101420
349 Ga0501041_0073944
350 Ga0501042_0070876
351 Ga0501043_0024979
352 Ga0501048_0035965
353 Ga0501048_0110162
354 Ga0501067_0028831
355 Ga0501068_0273528
356 Ga0501070_0372754
357 Ga0501071_0249995
358 Ga0501072_0082104
359 Ga0501073_0098918
360 Ga0501074_0041453
361 Ga0501074_0305984
362 Ga0501075_0126164
363 Ga0501076_0086605
364 Ga0501076_1143211
365 Ga0501077_0093590
366 Ga0501079_0038755
367 Ga0501079_0636579
368 Ga0501081_0325237
369 Ga0501083_0286920
370 Ga0501044_0027282
371 Ga0501045_0089051
372 nmdc:mga05p37_288364_c1
373 nmdc:mga0n895_873302_c1
374 Ga0495595_0043160
375 Ga0495619_0038851
376 Ga0501084_0104088
377 Ga0501084_0112308
378 Ga0501084_0323841
379 Ga0501084_0651241
380 Ga0501082_0061660
381 Ga0501082_0801598
382 Ga0466962_0036695
383 Ga0530510_0303734
384 2739606118
385 2760307223
386 2760624486
387 2809029346
388 2857742868
389 2910809757
390 2932431263
391 8054109289
392 8056583653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

41

135

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.8182 8 133
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.8078 8 130
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.8057 8 133
3vya-assembly1.cif.gz_A-2 w32y mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7641 14 133
7eg5-assembly1.cif.gz_B fmn-bound form of yvic from lactococcus lactis subsp. lactis il1403 0.7461 8 133
ID Description Score Start End Superfamily
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8069 9 132 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7821 9 130 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7763 9 132 2.30.110.10
af_F4J2F8_2_187_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7012 15 130 2.30.110.10
af_I1KGP8_130_285_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.701 13 138 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7Y5TFL3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9831 3 127
AF-A0A7V7ZHE3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9788 1 179
AF-A0A7Y5RMM7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9777 1 180
AF-A0A7Y5JRS5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9776 3 147
AF-H1YGY5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase-related FMN-binding protein 0.9766 1 179

Map