F301049

General Info

Members Datasets Scaffolds Average Seq Length
196 143 392 257

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100206003|Ga0070690_1002060032
Length 292
Sequence VIAYENPLMKIDPRLKRIVAAQPYPLLFATISGAHLYGFPSPDSDFDLRGAHVLPLEKVVGLGVRDETVEDSRVIEGLEMDIVSHDVRKFFGLLLKKNGYVLEQLFSPLIVHTTPEHAELKEICRARLNPRSSRGNEAQALDPEKSQSLLTSAATGVITKHHAHHYFGFAETQWKLFLKESPRRVKPLLYVYRVLLTGIHLMRTGEVEASLVTLNEEFQLPCIADLIARKLTGPEKSRLDDADLAFHESDYQRLRTELQAAHDASTLPELPSNETLGALNNLLVRIRTATKA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
142 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
143 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 2.04
Rhizosphere 90.82
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100206003 3300005330 Archaea 1371
2 Ga0065704_10096605 3300005289 Unclassified 2433
3 Ga0070676_10001304 3300005328 Bacteria 12539
4 Ga0070683_100175640 3300005329 Bacteria 2033
5 Ga0070683_100406206 3300005329 Bacteria 1299
6 Ga0070670_100233891 3300005331 Unclassified 1599
7 Ga0070666_10023132 3300005335 Bacteria 4042
8 Ga0070689_100092756 3300005340 Bacteria 2382
9 Ga0070689_100125239 3300005340 Archaea 2056
10 Ga0070691_10024711 3300005341 Bacteria 2793
11 Ga0070668_100047171 3300005347 Bacteria 3311
12 Ga0070668_100136818 3300005347 Bacteria 1971
13 Ga0070669_100012084 3300005353 Bacteria 6128
14 Ga0070674_100006737 3300005356 Bacteria 6726
15 Ga0070674_100107931 3300005356 Bacteria 2039
16 Ga0070673_100147473 3300005364 Bacteria 1990
17 Ga0070673_100697811 3300005364 Unclassified 932
18 Ga0070688_100475546 3300005365 Unclassified 938
19 Ga0070667_100140332 3300005367 Bacteria 2116
20 Ga0070709_10049422 3300005434 Bacteria 2630
21 Ga0070701_10059264 3300005438 Bacteria 2012
22 Ga0070700_100013347 3300005441 Bacteria 4613
23 Ga0070708_100181479 3300005445 Bacteria 1967
24 Ga0070678_100715481 3300005456 Bacteria 903
25 Ga0070662_100044145 3300005457 Bacteria 3192
26 Ga0068867_100005909 3300005459 Bacteria 8682
27 Ga0068867_100094871 3300005459 Bacteria 2269
28 Ga0070706_100321453 3300005467 Bacteria 1443
29 Ga0070707_100104845 3300005468 Bacteria 2741
30 Ga0070698_100079568 3300005471 Bacteria 3274
31 Ga0070698_100325085 3300005471 Bacteria 1469
32 Ga0070679_100222540 3300005530 Bacteria 1848
33 Ga0070684_100530893 3300005535 Bacteria 1091
34 Ga0068853_100091200 3300005539 Bacteria 2680
35 Ga0068853_100452864 3300005539 Unclassified 1207
36 Ga0068853_100842496 3300005539 Bacteria 879
37 Ga0070672_100049002 3300005543 Bacteria 3285
38 Ga0070686_100000390 3300005544 Bacteria 27797
39 Ga0070665_100159038 3300005548 Unclassified 2261
40 Ga0068856_100191606 3300005614 Bacteria 2058
41 Ga0068864_100361003 3300005618 Bacteria 1373
42 Ga0068861_100126729 3300005719 Bacteria 2067
43 Ga0068863_100489561 3300005841 Bacteria 1210
44 Ga0068863_100634751 3300005841 Bacteria 1058
45 Ga0068858_100322475 3300005842 Bacteria 1477
46 Ga0068860_100113535 3300005843 Unclassified 2590
47 Ga0068862_100272393 3300005844 Bacteria 1549
48 Ga0081455_10009919 3300005937 Bacteria 9742
49 Ga0081455_10025176 3300005937 Bacteria 5497
50 Ga0081455_10049582 3300005937 Bacteria 3618
51 Ga0081538_10083425 3300005981 Bacteria 1689
52 Ga0081539_10088978 3300005985 Unclassified 1600
53 Ga0070717_10000008 3300006028 Bacteria 299056
54 Ga0070717_10534963 3300006028 Viruses 1061
55 Ga0075365_10080766 3300006038 Bacteria 2202
56 Ga0075363_100163447 3300006048 Bacteria 1261
57 Ga0070712_100216385 3300006175 Bacteria 1514
58 Ga0075367_10034742 3300006178 Bacteria 2914
59 Ga0097621_100120360 3300006237 Bacteria 2226
60 Ga0075428_100362640 3300006844 Bacteria 1554
61 Ga0075430_100058538 3300006846 Bacteria 3239
62 Ga0075431_100071687 3300006847 Bacteria 3575
63 Ga0075431_100147847 3300006847 Bacteria 2420
64 Ga0075431_100231490 3300006847 Unclassified 1882
65 Ga0075431_100262650 3300006847 Bacteria 1752
66 Ga0075433_10375203 3300006852 Bacteria 1256
67 Ga0075434_100293968 3300006871 Bacteria 1644
68 Ga0075434_100318458 3300006871 Bacteria 1576
69 Ga0075429_100352978 3300006880 Unclassified 1287
70 Ga0068865_100018120 3300006881 Bacteria 4540
71 Ga0105240_10013883 3300009093 Bacteria 11033
72 Ga0105240_10095435 3300009093 Bacteria 3626
73 Ga0111539_10041377 3300009094 Bacteria 5540
74 Ga0111539_10077054 3300009094 Bacteria 3925
75 Ga0105245_10008147 3300009098 Bacteria 9165
76 Ga0114129_10262969 3300009147 Bacteria 2311
77 Ga0105243_10034015 3300009148 Bacteria 3943
78 Ga0105241_10124643 3300009174 Unclassified 2079
79 Ga0105237_10136921 3300009545 Unclassified 2443
80 Ga0105238_10000043 3300009551 Bacteria 154120
81 Ga0105238_10064024 3300009551 Bacteria 3678
82 Ga0105238_10080815 3300009551 Bacteria 3240
83 Ga0105239_10162413 3300010375 Unclassified 2496
84 Ga0105246_10507158 3300011119 Bacteria 1026
85 Ga0157374_10108079 3300013296 Bacteria 2673
86 Ga0157378_10038675 3300013297 Bacteria 4229
87 Ga0157378_10260945 3300013297 Unclassified 1662
88 Ga0157378_10482442 3300013297 Bacteria 1235
89 Ga0163162_10048770 3300013306 Unclassified 4243
90 Ga0163162_10804443 3300013306 Bacteria 1057
91 Ga0157375_10000021 3300013308 Bacteria 249616
92 Ga0157375_10904668 3300013308 Unclassified 1026
93 Ga0163163_10027009 3300014325 Bacteria 5493
94 Ga0163163_10254050 3300014325 Bacteria 1808
95 Ga0207680_10019140 3300025903 Bacteria 3657
96 Ga0207645_10003320 3300025907 Bacteria 12279
97 Ga0207684_10214108 3300025910 Bacteria 1662
98 Ga0207654_10170359 3300025911 Unclassified 1413
99 Ga0207707_10217206 3300025912 Bacteria 1665
100 Ga0207695_10021079 3300025913 Bacteria 7443
101 Ga0207695_10190886 3300025913 Bacteria 1966
102 Ga0207671_10036388 3300025914 Bacteria 3651
103 Ga0207652_10245641 3300025921 Bacteria 1614
104 Ga0207646_10019793 3300025922 Bacteria 6247
105 Ga0207681_10000664 3300025923 Bacteria 22785
106 Ga0207694_10000065 3300025924 Bacteria 131061
107 Ga0207694_10025524 3300025924 Bacteria 4492
108 Ga0207694_10039463 3300025924 Bacteria 3633
109 Ga0207694_10318911 3300025924 Bacteria 1282
110 Ga0207687_10008146 3300025927 Bacteria 6860
111 Ga0207670_10008204 3300025936 Bacteria 5880
112 Ga0207670_10059491 3300025936 Bacteria 2599
113 Ga0207669_10018256 3300025937 Bacteria 3621
114 Ga0207704_10019049 3300025938 Bacteria 3597
115 Ga0207704_10030418 3300025938 Unclassified 3027
116 Ga0207691_10009890 3300025940 Bacteria 9155
117 Ga0207668_10007516 3300025972 Bacteria 6484
118 Ga0207658_10030185 3300025986 Bacteria 3836
119 Ga0207639_10078182 3300026041 Bacteria 2611
120 Ga0207639_10315198 3300026041 Unclassified 1387
121 Ga0207708_10026973 3300026075 Bacteria 4349
122 Ga0207641_10156074 3300026088 Bacteria 2071
123 Ga0207648_10003219 3300026089 Bacteria 17188
124 Ga0207674_10256056 3300026116 Bacteria 1697
125 Ga0207675_100240192 3300026118 Bacteria 1750
126 Ga0207428_10011191 3300027907 Bacteria 7958
127 Ga0207428_10033287 3300027907 Bacteria 4235
128 Ga0268266_10116970 3300028379 Bacteria 2369
129 Ga0268264_10019770 3300028381 Bacteria 5501
130 Ga0268264_10093887 3300028381 Unclassified 2593
131 Ga0265326_10011752 3300028558 Bacteria 2578
132 Ga0265338_10000129 3300028800 Bacteria 138608
133 Ga0265338_10000196 3300028800 Bacteria 114348
134 Ga0265338_10003105 3300028800 Bacteria 23776
135 Ga0265338_10171582 3300028800 Bacteria 1663
136 Ga0265324_10000289 3300029957 Bacteria 37351
137 Ga0265320_10000197 3300031240 Bacteria 49509
138 Ga0265316_10360483 3300031344 Archaea 1051
139 Ga0307508_10000087 3300031616 Bacteria 108574
140 Ga0307406_10195309 3300031901 Bacteria 1485
141 Ga0307416_100135031 3300032002 Bacteria 2230
142 Ga0307416_100655303 3300032002 Bacteria 1135
143 Ga0307415_100203483 3300032126 Bacteria 1573
144 Ga0373950_0000033 3300034818 Bacteria 145634
145 Ga0373943_0000822 3300035170 Bacteria 13648
146 Ga0373927_0043678 3300035695 Bacteria 2901
147 Ga0373933_0007060 3300035724 Bacteria 6121
148 Ga0373937_0026251 3300036401 Bacteria 5263
149 Ga0395905_0073032 3300037471 Bacteria 3216
150 Ga0436365_0171040 3300039437 Bacteria 1675
151 Ga0451577_0170628 3300042876 Unclassified 1960
152 Ga0466972_0092289 3300044658 Bacteria 1436
153 Ga0453684_0001814 3300044712 Bacteria 56316
154 Ga0453684_0329165 3300044712 Unclassified 1728
155 Ga0451576_0101185 3300045051 Bacteria 2997
156 Ga0451576_0564228 3300045051 Bacteria 1196
157 Ga0451576_1088632 3300045051 Bacteria 836
158 Ga0495667_0100851 3300046559 Bacteria 1868
159 Ga0495674_0012126 3300047319 Bacteria 8124
160 Ga0496109_0014589 3300048912 Bacteria 6836
161 Ga0496112_0157289 3300048915 Bacteria 2239
162 Ga0496114_0444347 3300048917 Bacteria 1148
163 Ga0496115_0081378 3300048918 Bacteria 2638
164 Ga0501034_0009990 3300049571 Bacteria 9918
165 Ga0501034_0011739 3300049571 Bacteria 9063
166 Ga0501041_0461062 3300049577 Bacteria 807
167 Ga0501067_0001705 3300049583 Bacteria 12094
168 Ga0501067_0021543 3300049583 Unclassified 3567
169 Ga0501070_0159775 3300049586 Bacteria 1858
170 Ga0501073_0001209 3300049589 Bacteria 18812
171 Ga0501073_0011523 3300049589 Bacteria 6466
172 Ga0501080_0088013 3300049742 Bacteria 2885
173 Ga0501080_0342724 3300049742 Bacteria 1350
174 Ga0501083_0006286 3300049744 Bacteria 8428
175 Ga0501083_0027607 3300049744 Bacteria 3915
176 nmdc:mga03n38_125454_c1 3300050490 Bacteria 1266
177 nmdc:mga00v17_164296_c1 3300050491 Bacteria 1430
178 nmdc:mga00v17_64157_c1 3300050491 Bacteria 2263
179 nmdc:mga06z11_139794_c1 3300050494 Bacteria 1368
180 nmdc:mga05p37_122813_c1 3300050507 Bacteria 3190
181 nmdc:mga05p37_535993_c1 3300050507 Unclassified 1336
182 nmdc:mga09592_333035_c1 3300050508 Unclassified 1314
183 nmdc:mga0qj67_510323_c1 3300050509 Unclassified 966
184 nmdc:mga06r32_118881_c1 3300050510 Bacteria 2606
185 nmdc:mga06r32_147015_c1 3300050510 Bacteria 2334
186 nmdc:mga06r32_3955_c1 3300050510 Bacteria 13279
187 nmdc:mga06r32_758847_c1 3300050510 Bacteria 933
188 nmdc:mga08y16_1320_c1 3300050511 Bacteria 24657
189 nmdc:mga08y16_52798_c1 3300050511 Bacteria 4252
190 Ga0500641_0136940 3300053096 Bacteria 1057
191 Ga0500555_038123 3300053103 Unclassified 1345
192 Ga0500616_0000237 3300053153 Bacteria 86617
193 Ga0501084_0035104 3300054114 Bacteria 4192
194 2688391902 2687453341 Bacteria 6534136
195 2788435788 2786546940 Bacteria 6396474
196 2920109769 2920107658 Bacteria 10042636
197 Ga0070690_100206003
198 Ga0065704_10096605
199 Ga0070676_10001304
200 Ga0070683_100175640
201 Ga0070683_100406206
202 Ga0070670_100233891
203 Ga0070666_10023132
204 Ga0070689_100092756
205 Ga0070689_100125239
206 Ga0070691_10024711
207 Ga0070668_100047171
208 Ga0070668_100136818
209 Ga0070669_100012084
210 Ga0070674_100006737
211 Ga0070674_100107931
212 Ga0070673_100147473
213 Ga0070673_100697811
214 Ga0070688_100475546
215 Ga0070667_100140332
216 Ga0070709_10049422
217 Ga0070701_10059264
218 Ga0070700_100013347
219 Ga0070708_100181479
220 Ga0070678_100715481
221 Ga0070662_100044145
222 Ga0068867_100005909
223 Ga0068867_100094871
224 Ga0070706_100321453
225 Ga0070707_100104845
226 Ga0070698_100079568
227 Ga0070698_100325085
228 Ga0070679_100222540
229 Ga0070684_100530893
230 Ga0068853_100091200
231 Ga0068853_100452864
232 Ga0068853_100842496
233 Ga0070672_100049002
234 Ga0070686_100000390
235 Ga0070665_100159038
236 Ga0068856_100191606
237 Ga0068864_100361003
238 Ga0068861_100126729
239 Ga0068863_100489561
240 Ga0068863_100634751
241 Ga0068858_100322475
242 Ga0068860_100113535
243 Ga0068862_100272393
244 Ga0081455_10009919
245 Ga0081455_10025176
246 Ga0081455_10049582
247 Ga0081538_10083425
248 Ga0081539_10088978
249 Ga0070717_10000008
250 Ga0070717_10534963
251 Ga0075365_10080766
252 Ga0075363_100163447
253 Ga0070712_100216385
254 Ga0075367_10034742
255 Ga0097621_100120360
256 Ga0075428_100362640
257 Ga0075430_100058538
258 Ga0075431_100071687
259 Ga0075431_100147847
260 Ga0075431_100231490
261 Ga0075431_100262650
262 Ga0075433_10375203
263 Ga0075434_100293968
264 Ga0075434_100318458
265 Ga0075429_100352978
266 Ga0068865_100018120
267 Ga0105240_10013883
268 Ga0105240_10095435
269 Ga0111539_10041377
270 Ga0111539_10077054
271 Ga0105245_10008147
272 Ga0114129_10262969
273 Ga0105243_10034015
274 Ga0105241_10124643
275 Ga0105237_10136921
276 Ga0105238_10000043
277 Ga0105238_10064024
278 Ga0105238_10080815
279 Ga0105239_10162413
280 Ga0105246_10507158
281 Ga0157374_10108079
282 Ga0157378_10038675
283 Ga0157378_10260945
284 Ga0157378_10482442
285 Ga0163162_10048770
286 Ga0163162_10804443
287 Ga0157375_10000021
288 Ga0157375_10904668
289 Ga0163163_10027009
290 Ga0163163_10254050
291 Ga0207680_10019140
292 Ga0207645_10003320
293 Ga0207684_10214108
294 Ga0207654_10170359
295 Ga0207707_10217206
296 Ga0207695_10021079
297 Ga0207695_10190886
298 Ga0207671_10036388
299 Ga0207652_10245641
300 Ga0207646_10019793
301 Ga0207681_10000664
302 Ga0207694_10000065
303 Ga0207694_10025524
304 Ga0207694_10039463
305 Ga0207694_10318911
306 Ga0207687_10008146
307 Ga0207670_10008204
308 Ga0207670_10059491
309 Ga0207669_10018256
310 Ga0207704_10019049
311 Ga0207704_10030418
312 Ga0207691_10009890
313 Ga0207668_10007516
314 Ga0207658_10030185
315 Ga0207639_10078182
316 Ga0207639_10315198
317 Ga0207708_10026973
318 Ga0207641_10156074
319 Ga0207648_10003219
320 Ga0207674_10256056
321 Ga0207675_100240192
322 Ga0207428_10011191
323 Ga0207428_10033287
324 Ga0268266_10116970
325 Ga0268264_10019770
326 Ga0268264_10093887
327 Ga0265326_10011752
328 Ga0265338_10000129
329 Ga0265338_10000196
330 Ga0265338_10003105
331 Ga0265338_10171582
332 Ga0265324_10000289
333 Ga0265320_10000197
334 Ga0265316_10360483
335 Ga0307508_10000087
336 Ga0307406_10195309
337 Ga0307416_100135031
338 Ga0307416_100655303
339 Ga0307415_100203483
340 Ga0373950_0000033
341 Ga0373943_0000822
342 Ga0373927_0043678
343 Ga0373933_0007060
344 Ga0373937_0026251
345 Ga0395905_0073032
346 Ga0436365_0171040
347 Ga0451577_0170628
348 Ga0466972_0092289
349 Ga0453684_0001814
350 Ga0453684_0329165
351 Ga0451576_0101185
352 Ga0451576_0564228
353 Ga0451576_1088632
354 Ga0495667_0100851
355 Ga0495674_0012126
356 Ga0496109_0014589
357 Ga0496112_0157289
358 Ga0496114_0444347
359 Ga0496115_0081378
360 Ga0501034_0009990
361 Ga0501034_0011739
362 Ga0501041_0461062
363 Ga0501067_0001705
364 Ga0501067_0021543
365 Ga0501070_0159775
366 Ga0501073_0001209
367 Ga0501073_0011523
368 Ga0501080_0088013
369 Ga0501080_0342724
370 Ga0501083_0006286
371 Ga0501083_0027607
372 nmdc:mga03n38_125454_c1
373 nmdc:mga00v17_164296_c1
374 nmdc:mga00v17_64157_c1
375 nmdc:mga06z11_139794_c1
376 nmdc:mga05p37_122813_c1
377 nmdc:mga05p37_535993_c1
378 nmdc:mga09592_333035_c1
379 nmdc:mga0qj67_510323_c1
380 nmdc:mga06r32_118881_c1
381 nmdc:mga06r32_147015_c1
382 nmdc:mga06r32_3955_c1
383 nmdc:mga06r32_758847_c1
384 nmdc:mga08y16_1320_c1
385 nmdc:mga08y16_52798_c1
386 Ga0500641_0136940
387 Ga0500555_038123
388 Ga0500616_0000237
389 Ga0501084_0035104
390 2688391902
391 2788435788
392 2920109769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10127

RlaP

RNA repair pathway DNA polymerase beta family

9

136

0.88

PF10127

RlaP

RNA repair pathway DNA polymerase beta family

138

285

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ekk-assembly2.cif.gz_D crystal structure of gef domain of dennd 1a in complex with rab gtpase rab35-gdp bound state. 0.6948 64 82
3tw8-assembly2.cif.gz_D gef domain of dennd 1b in complex with rab gtpase rab35 0.6203 64 82
4g5r-assembly4.cif.gz_D structure of lgn gl4/galphai3 complex 0.6185 59 81
4g5s-assembly4.cif.gz_D structure of lgn gl3/galphai3 complex 0.6113 59 81
5c1t-assembly2.cif.gz_B crystal structure of the gtp-bound wild type ehrabx3 from entamoeba histolytica 0.6014 39 100
ID Description Score Start End Superfamily
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7552 10 86 3.30.460.10
3c18C01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7162 11 120 3.30.460.10
1knyB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6577 22 120 3.30.460.10
3c18C01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6515 11 120 3.30.460.10
af_Q5N789_30_143_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6361 25 80 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A2W0AQ14-F1-model_v4 Cysteine-rich CPCC domain-containing protein 0.9798 11 251
AF-A0A2D6PSE7-F1-model_v4 Nucleotidyltransferase 0.9783 5 255 GO:0016740
AF-A0A6P0Z217-F1-model_v4 Nucleotidyltransferase 0.978 17 179 GO:0016740
AF-A0A518L585-F1-model_v4 deleted 0.977 10 252
AF-A0A257TK49-F1-model_v4 Nucleotidyltransferase 0.9765 8 216 GO:0016740

Map