F300616

General Info

Members Datasets Scaffolds Average Seq Length
195 157 390 156

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0088310|Ga0495602_0088310_2084_2548
Length 154
Sequence MSNDTHGFELPLLLFGGFRSIIDELHAELARRGHPDVRPAHGFALQAIGLGGATATEAGRRLGVSKQAAGKTIDRLEELGYVHRSGDDADRRKLARLTPRGVEVLALSAMIFEDIRSRWAGTLGAGRLSDLEDGLRLMVPGEKFRLDVPGWFGG

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
58 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
61 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
115 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
116 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
118 2501939600 Micromonospora sp. L5 Isolate Unclassified
119 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
120 2547132424 Nocardia nova SH22a Isolate Unclassified
121 2558860280 Kutzneria sp. 744 Isolate Unclassified
122 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
123 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
124 2643221670 Streptomyces sp. Root431 Isolate Unclassified
125 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
126 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
127 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
128 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
129 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
130 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
131 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
132 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
133 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
134 2858882152 Micromonospora noduli MED15 Isolate Nodule
135 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
136 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
137 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
138 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
139 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
140 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
141 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
142 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
143 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
144 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
145 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
146 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
147 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
148 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
149 649633069 Micromonospora sp. L5 Isolate Unclassified
150 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
151 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
152 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
153 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
154 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
155 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
156 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
157 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.49
Metatranscriptomes 0
Isolates 20.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 3.08
Rhizoplane 1.03
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0088310 3300048088 Bacteria 2581
2 JGI25406J46586_10003220 3300003203 Bacteria 7680
3 Ga0070682_100251063 3300005337 Bacteria 1275
4 Ga0070668_100020666 3300005347 Bacteria 4970
5 Ga0070668_100933643 3300005347 Bacteria 777
6 Ga0070667_100230771 3300005367 Bacteria 1650
7 Ga0070714_100185747 3300005435 Bacteria 1894
8 Ga0070714_100582576 3300005435 Bacteria 1073
9 Ga0070714_100643139 3300005435 Bacteria 1020
10 Ga0070713_100097222 3300005436 Bacteria 2544
11 Ga0070713_100292685 3300005436 Bacteria 1497
12 Ga0070710_10061927 3300005437 Bacteria 2132
13 Ga0070710_10484999 3300005437 Bacteria 844
14 Ga0070711_100004200 3300005439 Bacteria 8465
15 Ga0070711_100027389 3300005439 Bacteria 3742
16 Ga0070700_100140327 3300005441 Bacteria 1642
17 Ga0070708_100033506 3300005445 Bacteria 4463
18 Ga0070708_100149819 3300005445 Bacteria 2169
19 Ga0070706_100015746 3300005467 Bacteria 6984
20 Ga0070706_100454423 3300005467 Bacteria 1192
21 Ga0070706_101160569 3300005467 Bacteria 710
22 Ga0070707_100096360 3300005468 Bacteria 2865
23 Ga0070707_100096779 3300005468 Bacteria 2859
24 Ga0070698_100011692 3300005471 Bacteria 9311
25 Ga0070698_100655871 3300005471 Bacteria 991
26 Ga0070699_100001550 3300005518 Bacteria 21017
27 Ga0070699_100004645 3300005518 Bacteria 12154
28 Ga0070697_100173036 3300005536 Unclassified 1828
29 Ga0068853_100132567 3300005539 Bacteria 2232
30 Ga0068862_100257390 3300005844 Bacteria 1592
31 Ga0081540_1002089 3300005983 Bacteria 16651
32 Ga0081539_10000125 3300005985 Bacteria 180646
33 Ga0070717_10016517 3300006028 Bacteria 5723
34 Ga0070717_10584745 3300006028 Bacteria 1012
35 Ga0070715_10022104 3300006163 Bacteria 2477
36 Ga0070716_100016515 3300006173 Bacteria 3812
37 Ga0070716_101143949 3300006173 Bacteria 623
38 Ga0070712_100033220 3300006175 Bacteria 3489
39 Ga0070712_100043490 3300006175 Bacteria 3092
40 Ga0075435_100079284 3300007076 Bacteria 2694
41 Ga0105238_10759840 3300009551 Bacteria 984
42 Ga0157376_10255184 3300014969 Bacteria 1640
43 Ga0224572_1005599 3300024225 Bacteria 2245
44 Ga0207426_1024949 3300025302 Bacteria 2020
45 Ga0207692_10047035 3300025898 Bacteria 2165
46 Ga0207692_10421270 3300025898 Bacteria 836
47 Ga0207699_10008888 3300025906 Bacteria 4979
48 Ga0207684_10262152 3300025910 Unclassified 1491
49 Ga0207693_10027087 3300025915 Bacteria 4533
50 Ga0207693_10099285 3300025915 Bacteria 2283
51 Ga0207693_10101513 3300025915 Bacteria 2256
52 Ga0207663_10885899 3300025916 Bacteria 713
53 Ga0207646_10013991 3300025922 Bacteria 7639
54 Ga0207646_10019126 3300025922 Bacteria 6369
55 Ga0207694_10099011 3300025924 Bacteria 2309
56 Ga0207700_10047891 3300025928 Bacteria 3171
57 Ga0207700_10065928 3300025928 Bacteria 2765
58 Ga0207700_10091421 3300025928 Bacteria 2404
59 Ga0207700_10750425 3300025928 Bacteria 872
60 Ga0207664_10076780 3300025929 Bacteria 2705
61 Ga0207664_10165756 3300025929 Bacteria 1888
62 Ga0207664_10385129 3300025929 Bacteria 1245
63 Ga0207664_11073001 3300025929 Bacteria 720
64 Ga0207665_10002210 3300025939 Bacteria 13128
65 Ga0207665_10967927 3300025939 Bacteria 676
66 Ga0207689_10008298 3300025942 Bacteria 9052
67 Ga0207668_10114563 3300025972 Bacteria 2029
68 Ga0207677_11093399 3300026023 Bacteria 726
69 Ga0207639_10203392 3300026041 Bacteria 1700
70 Ga0268265_10175652 3300028380 Bacteria 1835
71 Ga0307515_10187254 3300028794 Bacteria 1994
72 Ga0307511_10000250 3300030521 Bacteria 55086
73 Ga0307513_10064294 3300031456 Bacteria 3867
74 Ga0307513_10065082 3300031456 Bacteria 3836
75 Ga0307513_10155545 3300031456 Bacteria 2187
76 Ga0307408_101358717 3300031548 Bacteria 668
77 Ga0307405_10363854 3300031731 Bacteria 1120
78 Ga0307405_10414493 3300031731 Bacteria 1058
79 Ga0307413_10003275 3300031824 Bacteria 6791
80 Ga0307413_10750793 3300031824 Bacteria 815
81 Ga0307410_10488030 3300031852 Bacteria 1012
82 Ga0307406_11654319 3300031901 Bacteria 566
83 Ga0307407_11065738 3300031903 Bacteria 627
84 Ga0307411_10710883 3300032005 Bacteria 876
85 Ga0307415_100112427 3300032126 Bacteria 2024
86 Ga0307415_100274297 3300032126 Bacteria 1383
87 Ga0307415_100759579 3300032126 Bacteria 881
88 Ga0307507_10007761 3300033179 Bacteria 15306
89 Ga0316214_1046753 3300033545 Bacteria 625
90 Ga0373951_0000013 3300035091 Bacteria 71164
91 Ga0373923_0133207 3300035111 Bacteria 1118
92 Ga0373936_0272297 3300035113 Bacteria 760
93 Ga0373953_0005910 3300035117 Bacteria 4000
94 Ga0373954_0117513 3300035118 Bacteria 1289
95 Ga0373956_0006628 3300035119 Bacteria 4644
96 Ga0373957_0135374 3300035120 Bacteria 1005
97 Ga0373946_0241250 3300035171 Bacteria 879
98 Ga0373955_0015206 3300035172 Bacteria 3761
99 Ga0373955_0086454 3300035172 Bacteria 1781
100 Ga0373935_0265066 3300035692 Bacteria 1206
101 Ga0373933_0010439 3300035724 Bacteria 5091
102 Ga0373947_0208897 3300035725 Bacteria 1280
103 Ga0373937_0099214 3300036401 Bacteria 2701
104 Ga0373925_0348998 3300037068 Bacteria 1201
105 Ga0436364_0245091 3300037853 Bacteria 1804
106 Ga0436364_0420855 3300037853 Bacteria 3006
107 Ga0436364_1079409 3300037853 Bacteria 2967
108 Ga0451802_1881477 3300041460 Bacteria 577
109 Ga0466969_0001963 3300044656 Bacteria 10995
110 Ga0466972_0004361 3300044658 Bacteria 7071
111 Ga0466966_0004404 3300044684 Bacteria 9288
112 Ga0466961_0037495 3300044693 Bacteria 3109
113 Ga0466961_0484364 3300044693 Bacteria 748
114 Ga0466964_0115640 3300044706 Bacteria 1202
115 Ga0466968_0518556 3300044735 Bacteria 595
116 Ga0466970_0059713 3300044765 Bacteria 2042
117 Ga0466970_0419282 3300044765 Bacteria 765
118 Ga0466959_0094202 3300045049 Bacteria 2148
119 Ga0466958_0148766 3300045836 Bacteria 1477
120 Ga0466967_0493010 3300045976 Bacteria 1201
121 Ga0495592_0030252 3300046454 Bacteria 4096
122 Ga0495629_0444816 3300046459 Bacteria 878
123 Ga0495653_0025439 3300046463 Bacteria 4757
124 Ga0495662_0059190 3300046476 Bacteria 1850
125 Ga0495608_0047551 3300046511 Bacteria 2852
126 Ga0495618_0082778 3300046514 Bacteria 2049
127 Ga0495628_0091227 3300046516 Bacteria 2358
128 Ga0495652_0091864 3300046529 Bacteria 2480
129 Ga0495665_0280206 3300046531 Bacteria 855
130 Ga0495640_0043234 3300046533 Bacteria 3139
131 Ga0495586_0125860 3300046535 Bacteria 1433
132 Ga0495587_0094254 3300046536 Bacteria 1728
133 Ga0495645_0074344 3300046543 Bacteria 2447
134 Ga0495667_0057559 3300046559 Bacteria 2554
135 Ga0495634_0008428 3300046642 Bacteria 7675
136 Ga0495657_0041394 3300046675 Bacteria 3152
137 Ga0495599_0127586 3300046678 Bacteria 1580
138 Ga0495623_0083033 3300046679 Bacteria 1979
139 Ga0495646_0017568 3300046680 Bacteria 4535
140 Ga0495613_0022130 3300046689 Bacteria 4737
141 Ga0495624_0143701 3300046690 Bacteria 1461
142 Ga0495600_0057399 3300046809 Bacteria 2542
143 Ga0495604_0037389 3300047317 Bacteria 3824
144 Ga0495674_0095003 3300047319 Bacteria 2542
145 Ga0495680_0019206 3300047322 Bacteria 5780
146 Ga0495675_0056709 3300047444 Bacteria 2484
147 Ga0495684_0004263 3300047471 Bacteria 11158
148 Ga0495602_0114112 3300048088 Bacteria 2188
149 Ga0496115_0074878 3300048918 Bacteria 2749
150 Ga0495601_0134635 3300053077 Bacteria 1610
151 Ga0495612_0174657 3300053078 Bacteria 942
152 Ga0500577_0022322 3300053142 Bacteria 2098
153 Ga0500589_219526 3300053147 Bacteria 717
154 Ga0500634_0230260 3300053161 Bacteria 787
155 Ga0466962_0176228 3300061719 Bacteria 1042
156 2501945965 2501939600 Bacteria 6907073
157 2515856681 2515154155 Bacteria 7985436
158 2548697951 2547132424 Bacteria 8348532
159 2559424303 2558860280 Bacteria 11429938
160 2623586109 2622736626 Bacteria 7181580
161 2643942204 2643221587 Bacteria 7586415
162 2644389873 2643221670 Bacteria 6497041
163 2644429287 2643221677 Bacteria 7584031
164 2676490316 2675903060 Bacteria 10051191
165 2753070266 2751185734 Bacteria 8863695
166 2816422876 2816332119 Bacteria 8120218
167 2855671688 2855670206 Bacteria 7120389
168 2855683215 2855676851 Bacteria 7063653
169 2856860001 2856858025 Bacteria 7255264
170 2857294261 2857288857 Bacteria 7189066
171 2858852332 2858848962 Bacteria 6963058
172 2858887917 2858882152 Bacteria 7230291
173 2858890443 2858888857 Bacteria 7060307
174 2858898902 2858895516 Bacteria 7378898
175 2869054505 2869048445 Bacteria 6875584
176 2869067418 2869061728 Bacteria 7112407
177 2869071119 2869068681 Bacteria 7205615
178 2870729930 2870721527 Bacteria 9689237
179 2880494154 2880489317 Bacteria 7096270
180 2880498174 2880495981 Bacteria 7340502
181 2891554812 2891554331 Bacteria 8812224
182 2917743679 2917736166 Bacteria 9690793
183 2918505615 2918501144 Bacteria 8668083
184 2919715874 2919713450 Bacteria 7431245
185 2929226752 2929226422 Bacteria 7248583
186 2996226190 2996221748 Bacteria 6799777
187 649810485 649633069 Bacteria 6962533
188 8003876681 8003870546 Bacteria 7396674
189 8025538013 8025530807 Bacteria 8495698
190 8054164551 8054160619 Bacteria 7783213
191 8054705434 8054704163 Bacteria 7247792
192 8054728103 8054727385 Bacteria 7558670
193 8054740856 8054734606 Bacteria 6947278
194 8055417054 8055412473 Bacteria 6257500
195 8056212632 8056207758 Bacteria 8639239
196 Ga0495602_0088310
197 JGI25406J46586_10003220
198 Ga0070682_100251063
199 Ga0070668_100020666
200 Ga0070668_100933643
201 Ga0070667_100230771
202 Ga0070714_100185747
203 Ga0070714_100582576
204 Ga0070714_100643139
205 Ga0070713_100097222
206 Ga0070713_100292685
207 Ga0070710_10061927
208 Ga0070710_10484999
209 Ga0070711_100004200
210 Ga0070711_100027389
211 Ga0070700_100140327
212 Ga0070708_100033506
213 Ga0070708_100149819
214 Ga0070706_100015746
215 Ga0070706_100454423
216 Ga0070706_101160569
217 Ga0070707_100096360
218 Ga0070707_100096779
219 Ga0070698_100011692
220 Ga0070698_100655871
221 Ga0070699_100001550
222 Ga0070699_100004645
223 Ga0070697_100173036
224 Ga0068853_100132567
225 Ga0068862_100257390
226 Ga0081540_1002089
227 Ga0081539_10000125
228 Ga0070717_10016517
229 Ga0070717_10584745
230 Ga0070715_10022104
231 Ga0070716_100016515
232 Ga0070716_101143949
233 Ga0070712_100033220
234 Ga0070712_100043490
235 Ga0075435_100079284
236 Ga0105238_10759840
237 Ga0157376_10255184
238 Ga0224572_1005599
239 Ga0207426_1024949
240 Ga0207692_10047035
241 Ga0207692_10421270
242 Ga0207699_10008888
243 Ga0207684_10262152
244 Ga0207693_10027087
245 Ga0207693_10099285
246 Ga0207693_10101513
247 Ga0207663_10885899
248 Ga0207646_10013991
249 Ga0207646_10019126
250 Ga0207694_10099011
251 Ga0207700_10047891
252 Ga0207700_10065928
253 Ga0207700_10091421
254 Ga0207700_10750425
255 Ga0207664_10076780
256 Ga0207664_10165756
257 Ga0207664_10385129
258 Ga0207664_11073001
259 Ga0207665_10002210
260 Ga0207665_10967927
261 Ga0207689_10008298
262 Ga0207668_10114563
263 Ga0207677_11093399
264 Ga0207639_10203392
265 Ga0268265_10175652
266 Ga0307515_10187254
267 Ga0307511_10000250
268 Ga0307513_10064294
269 Ga0307513_10065082
270 Ga0307513_10155545
271 Ga0307408_101358717
272 Ga0307405_10363854
273 Ga0307405_10414493
274 Ga0307413_10003275
275 Ga0307413_10750793
276 Ga0307410_10488030
277 Ga0307406_11654319
278 Ga0307407_11065738
279 Ga0307411_10710883
280 Ga0307415_100112427
281 Ga0307415_100274297
282 Ga0307415_100759579
283 Ga0307507_10007761
284 Ga0316214_1046753
285 Ga0373951_0000013
286 Ga0373923_0133207
287 Ga0373936_0272297
288 Ga0373953_0005910
289 Ga0373954_0117513
290 Ga0373956_0006628
291 Ga0373957_0135374
292 Ga0373946_0241250
293 Ga0373955_0015206
294 Ga0373955_0086454
295 Ga0373935_0265066
296 Ga0373933_0010439
297 Ga0373947_0208897
298 Ga0373937_0099214
299 Ga0373925_0348998
300 Ga0436364_0245091
301 Ga0436364_0420855
302 Ga0436364_1079409
303 Ga0451802_1881477
304 Ga0466969_0001963
305 Ga0466972_0004361
306 Ga0466966_0004404
307 Ga0466961_0037495
308 Ga0466961_0484364
309 Ga0466964_0115640
310 Ga0466968_0518556
311 Ga0466970_0059713
312 Ga0466970_0419282
313 Ga0466959_0094202
314 Ga0466958_0148766
315 Ga0466967_0493010
316 Ga0495592_0030252
317 Ga0495629_0444816
318 Ga0495653_0025439
319 Ga0495662_0059190
320 Ga0495608_0047551
321 Ga0495618_0082778
322 Ga0495628_0091227
323 Ga0495652_0091864
324 Ga0495665_0280206
325 Ga0495640_0043234
326 Ga0495586_0125860
327 Ga0495587_0094254
328 Ga0495645_0074344
329 Ga0495667_0057559
330 Ga0495634_0008428
331 Ga0495657_0041394
332 Ga0495599_0127586
333 Ga0495623_0083033
334 Ga0495646_0017568
335 Ga0495613_0022130
336 Ga0495624_0143701
337 Ga0495600_0057399
338 Ga0495604_0037389
339 Ga0495674_0095003
340 Ga0495680_0019206
341 Ga0495675_0056709
342 Ga0495684_0004263
343 Ga0495602_0114112
344 Ga0496115_0074878
345 Ga0495601_0134635
346 Ga0495612_0174657
347 Ga0500577_0022322
348 Ga0500589_219526
349 Ga0500634_0230260
350 Ga0466962_0176228
351 2501945965
352 2515856681
353 2548697951
354 2559424303
355 2623586109
356 2643942204
357 2644389873
358 2644429287
359 2676490316
360 2753070266
361 2816422876
362 2855671688
363 2855683215
364 2856860001
365 2857294261
366 2858852332
367 2858887917
368 2858890443
369 2858898902
370 2869054505
371 2869067418
372 2869071119
373 2870729930
374 2880494154
375 2880498174
376 2891554812
377 2917743679
378 2918505615
379 2919715874
380 2929226752
381 2996226190
382 649810485
383 8003876681
384 8025538013
385 8054164551
386 8054705434
387 8054728103
388 8054740856
389 8055417054
390 8056212632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

49

94

0.94

PF12802

MarR_2

MarR family

36

93

0.92

PF13463

HTH_27

Winged helix DNA-binding domain

38

101

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9121 50 95
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9041 51 96
6wxq-assembly1.cif.gz_B crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.8948 48 102
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.893 51 96
1sfu-assembly1.cif.gz_B crystal structure of the viral zalpha domain bound to left-handed z-dna 0.89 49 95
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9391 50 95 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9244 51 95 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 50 95 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9103 49 95 3.30.230.130
2xv4S01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9075 49 96 1.10.10.10
ID Description Score Start End GO Terms
AF-V6JYY5-F1-model_v4 deleted 0.9816 24 150
AF-A0A1M6JN90-F1-model_v4 MarR family protein 0.9563 10 139 GO:0003677
GO:0003700
GO:0006950
AF-I9KHX0-F1-model_v4 Transcriptional regulator 0.9494 3 136 GO:0003700
GO:0006950
AF-A0A7K2HAI3-F1-model_v4 deleted 0.949 1 139
AF-V6JYY5-F1-model_v4 deleted 0.9449 24 150

Map