F300525

General Info

Members Datasets Scaffolds Average Seq Length
195 124 390 312

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0010724|Ga0495603_0010724_2578_3576
Length 332
Sequence LLWTENIMSKTSRIAGAVIGMVALAGSLAACGGDSLEKDKGGSAASGDSGKKGSLVVGAAAFTESKVLAELYAQILGDAGYSTSVTTVKNRELYEPSLEKGEIDVVPEYAATIAEFLNAKANGAKTAEKNPVASGDAAATTAALEKLATARGLKVLPYGEAVDQNAFAVTKEFADKNKLKTLSDLGASKLKVKIAAGDECEVRPFCAPGLKKTYGIDVTGIDPKGVGTPQSKQAVKDGKDQLVLTTTTDAVLDSFNLVFLEDDKKLQNADNVVPVLNAKDAGAQDIADALGKLTKTLTTEDLAELNRKVDAERAKPADVAKDYLQSKGLIKK

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
3 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
4 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
5 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
6 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
7 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
8 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
9 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
10 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
11 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
12 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
13 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
14 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
15 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
16 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
17 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
18 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
19 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
20 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
21 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
22 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
23 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
24 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
25 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
26 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
27 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
28 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
29 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
30 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
31 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
32 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
33 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
34 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
35 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
36 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
37 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
38 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
39 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
40 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
41 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
42 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
43 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
44 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
45 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
46 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
47 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
48 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
49 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
50 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
51 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
52 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
53 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
54 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
55 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
56 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
57 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
58 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
59 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
60 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
61 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
62 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
63 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
64 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
65 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
66 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
67 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
68 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
69 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
70 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
71 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
72 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
73 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
79 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
82 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
83 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
84 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
85 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
86 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
87 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
88 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
89 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
90 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
91 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
92 2643221548 Streptomyces sp. Root55 Isolate Unclassified
93 2643221578 Streptomyces sp. Root63 Isolate Unclassified
94 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
95 2643221670 Streptomyces sp. Root431 Isolate Unclassified
96 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
97 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
98 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
99 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
100 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
101 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
102 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
103 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
104 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
105 2862574272 Streptomyces sp. AcE210 Isolate Nodule
106 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
107 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
108 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
109 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
110 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
111 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
112 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
113 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
114 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
115 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
116 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
117 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
118 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
119 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
120 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
121 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
122 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
123 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
124 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.36
Metatranscriptomes 0
Isolates 25.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0.51
Rhizoplane 0
Rhizosphere 76.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0010724 3300046455 Bacteria 5557
2 Ga0183367_1016 3300015688 Bacteria 290198
3 Ga0207426_1002556 3300025302 Bacteria 11389
4 Ga0207426_1007332 3300025302 Bacteria 4630
5 Ga0307517_10005215 3300028786 Bacteria 19679
6 Ga0307515_10002574 3300028794 Bacteria 39147
7 Ga0307515_10246462 3300028794 Bacteria 1547
8 Ga0307511_10000010 3300030521 Bacteria 146716
9 Ga0307511_10036096 3300030521 Bacteria 4299
10 Ga0307512_10014901 3300030522 Bacteria 7227
11 Ga0307512_10038482 3300030522 Bacteria 4022
12 Ga0307513_10014699 3300031456 Bacteria 9525
13 Ga0307513_10055216 3300031456 Bacteria 4252
14 Ga0307509_10008776 3300031507 Bacteria 12782
15 Ga0307509_10022555 3300031507 Bacteria 7093
16 Ga0307509_10129608 3300031507 Bacteria 2481
17 Ga0307508_10014360 3300031616 Bacteria 7225
18 Ga0307514_10081806 3300031649 Bacteria 2385
19 Ga0307514_10086042 3300031649 Bacteria 2308
20 Ga0307507_10017755 3300033179 Bacteria 8146
21 Ga0307507_10033819 3300033179 Bacteria 5299
22 Ga0307510_10001558 3300033180 Bacteria 25339
23 Ga0307510_10128257 3300033180 Bacteria 2219
24 Ga0307510_10188423 3300033180 Bacteria 1614
25 Ga0395898_0006033 3300037466 Bacteria 13010
26 Ga0395898_0254679 3300037466 Bacteria 1674
27 Ga0395905_0031984 3300037471 Bacteria 4950
28 Ga0466969_0085264 3300044656 Bacteria 1502
29 Ga0466965_0000921 3300044683 Bacteria 11282
30 Ga0466966_0007816 3300044684 Bacteria 7079
31 Ga0466961_0001145 3300044693 Bacteria 16292
32 Ga0466963_0000080 3300044694 Bacteria 32971
33 Ga0466971_0000199 3300044719 Bacteria 23105
34 Ga0466968_0071837 3300044735 Bacteria 1508
35 Ga0466970_0000530 3300044765 Bacteria 18703
36 Ga0466957_0000128 3300044842 Bacteria 32238
37 Ga0466959_0001720 3300045049 Bacteria 13601
38 Ga0466958_0007405 3300045836 Bacteria 6036
39 Ga0466967_0044794 3300045976 Bacteria 3840
40 Ga0466967_0191412 3300045976 Bacteria 1933
41 Ga0495592_0085215 3300046454 Bacteria 2278
42 Ga0495603_0000653 3300046455 Bacteria 19592
43 Ga0495603_0001094 3300046455 Bacteria 15733
44 Ga0495603_0006228 3300046455 Bacteria 7134
45 Ga0495603_0047983 3300046455 Bacteria 2542
46 Ga0495603_0051990 3300046455 Bacteria 2433
47 Ga0495590_0050642 3300046457 Bacteria 1450
48 Ga0495629_0001188 3300046459 Bacteria 20533
49 Ga0495629_0001192 3300046459 Bacteria 20488
50 Ga0495629_0001822 3300046459 Bacteria 16694
51 Ga0495629_0002210 3300046459 Bacteria 15007
52 Ga0495629_0007731 3300046459 Bacteria 7911
53 Ga0495629_0219098 3300046459 Bacteria 1313
54 Ga0495629_0288756 3300046459 Bacteria 1125
55 Ga0495638_0175886 3300046460 Bacteria 1225
56 Ga0495651_0005523 3300046462 Bacteria 9641
57 Ga0495662_0002010 3300046476 Bacteria 10177
58 Ga0495664_0001064 3300046477 Bacteria 14191
59 Ga0495664_0074313 3300046477 Bacteria 2033
60 Ga0495585_0020161 3300046492 Bacteria 3836
61 Ga0495594_0000260 3300046499 Bacteria 25795
62 Ga0495594_0000428 3300046499 Bacteria 21181
63 Ga0495618_0055190 3300046514 Bacteria 2515
64 Ga0495630_0019870 3300046517 Bacteria 4945
65 Ga0495666_0022266 3300046526 Bacteria 3137
66 Ga0495642_0067377 3300046528 Bacteria 1493
67 Ga0495652_0052810 3300046529 Bacteria 3465
68 Ga0495640_0005927 3300046533 Bacteria 9687
69 Ga0495586_0045489 3300046535 Bacteria 2365
70 Ga0495587_0006015 3300046536 Bacteria 7909
71 Ga0495645_0052246 3300046543 Bacteria 2974
72 Ga0495622_0007124 3300046557 Bacteria 5196
73 Ga0495622_0046535 3300046557 Bacteria 2015
74 Ga0495668_0116890 3300046616 Bacteria 1458
75 Ga0495634_0006757 3300046642 Bacteria 8688
76 Ga0495611_0008560 3300046648 Bacteria 4325
77 Ga0495611_0031134 3300046648 Bacteria 2347
78 Ga0495611_0098981 3300046648 Bacteria 1353
79 Ga0495611_0099207 3300046648 Bacteria 1351
80 Ga0495625_0016005 3300046660 Bacteria 5914
81 Ga0495625_0080194 3300046660 Bacteria 2274
82 Ga0495635_0010627 3300046663 Bacteria 6442
83 Ga0495635_0015731 3300046663 Bacteria 5285
84 Ga0495661_0148524 3300046665 Bacteria 1268
85 Ga0495588_0001970 3300046674 Bacteria 8771
86 Ga0495588_0030156 3300046674 Bacteria 2725
87 Ga0495588_0034154 3300046674 Bacteria 2572
88 Ga0495657_0012433 3300046675 Bacteria 6326
89 Ga0495657_0023068 3300046675 Bacteria 4451
90 Ga0495657_0058460 3300046675 Bacteria 2560
91 Ga0495646_0000204 3300046680 Bacteria 29112
92 Ga0495658_0020007 3300046683 Bacteria 3504
93 Ga0495613_0000387 3300046689 Bacteria 38006
94 Ga0495613_0000570 3300046689 Bacteria 30354
95 Ga0495613_0004366 3300046689 Bacteria 10579
96 Ga0495613_0023388 3300046689 Bacteria 4603
97 Ga0495670_0113470 3300046691 Bacteria 1404
98 Ga0495649_0145905 3300046694 Bacteria 1244
99 Ga0495589_0020507 3300046794 Bacteria 3380
100 Ga0495589_0030735 3300046794 Bacteria 2704
101 Ga0495589_0071784 3300046794 Bacteria 1691
102 Ga0495589_0096996 3300046794 Bacteria 1428
103 Ga0495600_0023542 3300046809 Bacteria 3962
104 Ga0495581_0024081 3300047315 Bacteria 3527
105 Ga0495604_0003537 3300047317 Bacteria 12454
106 Ga0495604_0039447 3300047317 Bacteria 3711
107 Ga0495604_0165253 3300047317 Bacteria 1561
108 Ga0495676_0001241 3300047321 Bacteria 21877
109 Ga0495676_0001764 3300047321 Bacteria 18899
110 Ga0495676_0003951 3300047321 Bacteria 13491
111 Ga0495676_0009021 3300047321 Bacteria 9101
112 Ga0495676_0013375 3300047321 Bacteria 7374
113 Ga0495676_0024190 3300047321 Bacteria 5261
114 Ga0495676_0095304 3300047321 Bacteria 2214
115 Ga0495687_002208 3300047443 Bacteria 16078
116 Ga0495687_020075 3300047443 Bacteria 3264
117 Ga0495675_0079148 3300047444 Bacteria 2070
118 Ga0495685_000743 3300047447 Bacteria 9986
119 Ga0495685_019725 3300047447 Bacteria 2316
120 Ga0495685_034339 3300047447 Bacteria 1742
121 Ga0495673_0071866 3300047469 Bacteria 1454
122 Ga0495686_0050097 3300047472 Bacteria 2625
123 Ga0495593_0028740 3300047673 Bacteria 3052
124 Ga0495602_0121829 3300048088 Bacteria 2097
125 Ga0495614_0002031 3300048089 Bacteria 8900
126 Ga0495614_0006122 3300048089 Bacteria 5407
127 Ga0495614_0042369 3300048089 Bacteria 1951
128 Ga0495614_0093381 3300048089 Bacteria 1310
129 Ga0501032_0066695 3300049569 Bacteria 2405
130 Ga0501036_0164858 3300049572 Bacteria 1868
131 Ga0501038_0000183 3300049574 Bacteria 53678
132 Ga0501047_0080423 3300049581 Bacteria 3132
133 Ga0501073_0092664 3300049589 Bacteria 2100
134 Ga0501080_0073484 3300049742 Bacteria 3181
135 Ga0501035_0217660 3300049822 Bacteria 1632
136 Ga0501044_0002818 3300049823 Bacteria 19811
137 Ga0501044_0017337 3300049823 Bacteria 7724
138 Ga0501044_0059178 3300049823 Bacteria 3926
139 Ga0500644_0010246 3300053088 Bacteria 2532
140 Ga0500640_023204 3300053095 Bacteria 2685
141 Ga0500553_065329 3300053101 Bacteria 1690
142 Ga0500560_036787 3300053107 Bacteria 1513
143 Ga0500572_011697 3300053111 Bacteria 2131
144 Ga0500573_0021680 3300053140 Bacteria 3685
145 Ga0466962_0000507 3300061719 Bacteria 16942
146 2554257028 2554235005 Bacteria 6457341
147 2585298081 2582581312 Bacteria 7308206
148 2616696180 2616644814 Bacteria 11555299
149 2616903562 2616644941 Bacteria 8510691
150 2616903613 2616644941 Bacteria 8510691
151 2643763496 2643221548 Bacteria 8053412
152 2643899698 2643221578 Bacteria 9213798
153 2643901110 2643221578 Bacteria 9213798
154 2643943118 2643221587 Bacteria 7586415
155 2643947645 2643221587 Bacteria 7586415
156 2644390171 2643221670 Bacteria 6497041
157 2644403666 2643221673 Bacteria 9196637
158 2644407254 2643221673 Bacteria 9196637
159 2644430578 2643221677 Bacteria 7584031
160 2644435337 2643221677 Bacteria 7584031
161 2644463636 2643221682 Bacteria 6743283
162 2804843242 2802429296 Bacteria 7227771
163 2804845877 2802429296 Bacteria 7227771
164 2811845351 2808606982 Bacteria 7791042
165 2819698274 2818991463 Bacteria 7948711
166 2862179498 2862178590 Bacteria 8583590
167 2862185865 2862178590 Bacteria 8583590
168 2862282803 2862281513 Bacteria 9621493
169 2862293297 2862290372 Bacteria 7471434
170 2862296067 2862290372 Bacteria 7471434
171 2862575160 2862574272 Bacteria 10567477
172 2875394668 2875391855 Bacteria 7600475
173 2875398265 2875391855 Bacteria 7600475
174 2912715654 2912715099 Bacteria 9460473
175 2912761869 2912757875 Bacteria 7940295
176 2918504607 2918501144 Bacteria 8668083
177 2918508106 2918501144 Bacteria 8668083
178 2935392654 2935390628 Bacteria 7043367
179 2946046009 2946045630 Bacteria 8527308
180 2946049967 2946045630 Bacteria 8527308
181 2966602476 2966598605 Bacteria 7676064
182 2990091292 2990088156 Bacteria 6657676
183 2997454271 2997451912 Bacteria 8492419
184 3006396471 3006393351 Bacteria 6615579
185 3006428463 3006425503 Bacteria 6491253
186 3006492234 3006486233 Bacteria 8157040
187 3006495743 3006493962 Bacteria 8825450
188 8008575607 8008574985 Bacteria 7815457
189 8025415821 8025413630 Bacteria 7014048
190 8025416605 8025413630 Bacteria 7014048
191 8025483314 8025478263 Bacteria 8209203
192 8025536815 8025530807 Bacteria 8495698
193 8025538137 8025530807 Bacteria 8495698
194 8054166949 8054160619 Bacteria 7783213
195 8056832291 8056829672 Bacteria 9045328
196 Ga0495603_0010724
197 Ga0183367_1016
198 Ga0207426_1002556
199 Ga0207426_1007332
200 Ga0307517_10005215
201 Ga0307515_10002574
202 Ga0307515_10246462
203 Ga0307511_10000010
204 Ga0307511_10036096
205 Ga0307512_10014901
206 Ga0307512_10038482
207 Ga0307513_10014699
208 Ga0307513_10055216
209 Ga0307509_10008776
210 Ga0307509_10022555
211 Ga0307509_10129608
212 Ga0307508_10014360
213 Ga0307514_10081806
214 Ga0307514_10086042
215 Ga0307507_10017755
216 Ga0307507_10033819
217 Ga0307510_10001558
218 Ga0307510_10128257
219 Ga0307510_10188423
220 Ga0395898_0006033
221 Ga0395898_0254679
222 Ga0395905_0031984
223 Ga0466969_0085264
224 Ga0466965_0000921
225 Ga0466966_0007816
226 Ga0466961_0001145
227 Ga0466963_0000080
228 Ga0466971_0000199
229 Ga0466968_0071837
230 Ga0466970_0000530
231 Ga0466957_0000128
232 Ga0466959_0001720
233 Ga0466958_0007405
234 Ga0466967_0044794
235 Ga0466967_0191412
236 Ga0495592_0085215
237 Ga0495603_0000653
238 Ga0495603_0001094
239 Ga0495603_0006228
240 Ga0495603_0047983
241 Ga0495603_0051990
242 Ga0495590_0050642
243 Ga0495629_0001188
244 Ga0495629_0001192
245 Ga0495629_0001822
246 Ga0495629_0002210
247 Ga0495629_0007731
248 Ga0495629_0219098
249 Ga0495629_0288756
250 Ga0495638_0175886
251 Ga0495651_0005523
252 Ga0495662_0002010
253 Ga0495664_0001064
254 Ga0495664_0074313
255 Ga0495585_0020161
256 Ga0495594_0000260
257 Ga0495594_0000428
258 Ga0495618_0055190
259 Ga0495630_0019870
260 Ga0495666_0022266
261 Ga0495642_0067377
262 Ga0495652_0052810
263 Ga0495640_0005927
264 Ga0495586_0045489
265 Ga0495587_0006015
266 Ga0495645_0052246
267 Ga0495622_0007124
268 Ga0495622_0046535
269 Ga0495668_0116890
270 Ga0495634_0006757
271 Ga0495611_0008560
272 Ga0495611_0031134
273 Ga0495611_0098981
274 Ga0495611_0099207
275 Ga0495625_0016005
276 Ga0495625_0080194
277 Ga0495635_0010627
278 Ga0495635_0015731
279 Ga0495661_0148524
280 Ga0495588_0001970
281 Ga0495588_0030156
282 Ga0495588_0034154
283 Ga0495657_0012433
284 Ga0495657_0023068
285 Ga0495657_0058460
286 Ga0495646_0000204
287 Ga0495658_0020007
288 Ga0495613_0000387
289 Ga0495613_0000570
290 Ga0495613_0004366
291 Ga0495613_0023388
292 Ga0495670_0113470
293 Ga0495649_0145905
294 Ga0495589_0020507
295 Ga0495589_0030735
296 Ga0495589_0071784
297 Ga0495589_0096996
298 Ga0495600_0023542
299 Ga0495581_0024081
300 Ga0495604_0003537
301 Ga0495604_0039447
302 Ga0495604_0165253
303 Ga0495676_0001241
304 Ga0495676_0001764
305 Ga0495676_0003951
306 Ga0495676_0009021
307 Ga0495676_0013375
308 Ga0495676_0024190
309 Ga0495676_0095304
310 Ga0495687_002208
311 Ga0495687_020075
312 Ga0495675_0079148
313 Ga0495685_000743
314 Ga0495685_019725
315 Ga0495685_034339
316 Ga0495673_0071866
317 Ga0495686_0050097
318 Ga0495593_0028740
319 Ga0495602_0121829
320 Ga0495614_0002031
321 Ga0495614_0006122
322 Ga0495614_0042369
323 Ga0495614_0093381
324 Ga0501032_0066695
325 Ga0501036_0164858
326 Ga0501038_0000183
327 Ga0501047_0080423
328 Ga0501073_0092664
329 Ga0501080_0073484
330 Ga0501035_0217660
331 Ga0501044_0002818
332 Ga0501044_0017337
333 Ga0501044_0059178
334 Ga0500644_0010246
335 Ga0500640_023204
336 Ga0500553_065329
337 Ga0500560_036787
338 Ga0500572_011697
339 Ga0500573_0021680
340 Ga0466962_0000507
341 2554257028
342 2585298081
343 2616696180
344 2616903562
345 2616903613
346 2643763496
347 2643899698
348 2643901110
349 2643943118
350 2643947645
351 2644390171
352 2644403666
353 2644407254
354 2644430578
355 2644435337
356 2644463636
357 2804843242
358 2804845877
359 2811845351
360 2819698274
361 2862179498
362 2862185865
363 2862282803
364 2862293297
365 2862296067
366 2862575160
367 2875394668
368 2875398265
369 2912715654
370 2912761869
371 2918504607
372 2918508106
373 2935392654
374 2946046009
375 2946049967
376 2966602476
377 2990091292
378 2997454271
379 3006396471
380 3006428463
381 3006492234
382 3006495743
383 8008575607
384 8025415821
385 8025416605
386 8025483314
387 8025536815
388 8025538137
389 8054166949
390 8056832291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

53

326

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f56-assembly1.cif.gz_A structure of recj complexed with dna and ssb-ct 0.9045 37 71
6lrd-assembly1.cif.gz_A structure of recj complexed with a 5'-p-dspacer-modified ssdna 0.8987 37 71
6nt1-assembly1.cif.gz_A catalase 3 from n.crassa in ferrous state (2.89 mgy) 0.8719 34 70
6nsy-assembly1.cif.gz_A x-ray reduced catalase 3 from n.crassa in cpd i state (0.263 mgy) 0.8706 34 70
3mam-assembly1.cif.gz_A a molecular switch changes the low to the high affinity state in the substrate binding protein afprox 0.8527 37 311
ID Description Score Start End Superfamily
3s2uA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9302 37 68 3.40.50.2000
5f56A02 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.9045 37 71 3.90.1640.30
af_O69725_44_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8929 41 308 3.40.190.10
3f6sB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8845 37 70 3.40.50.360
af_O69725_44_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8804 41 308 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0N0TP48-F1-model_v4 ABC transporter substrate-binding protein 0.9875 28 311 GO:0022857
GO:0043190
AF-A0A1Q4UYA8-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9836 37 311 GO:0022857
GO:0043190
AF-A0A2M9IZT5-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9788 37 311 GO:0022857
GO:0043190
AF-A0A6I5CT68-F1-model_v4 ABC transporter substrate-binding protein 0.9785 153 311 GO:0022857
GO:0043190
AF-A0A6G3XIS6-F1-model_v4 ABC transporter substrate-binding protein 0.9784 116 293 GO:0022857
GO:0043190

Map