F300188
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 195 | 144 | 189 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10002023|Ga0207695_1000202317 |
| Length | 225 |
| Sequence | MVNFVESKDRANSRKTNPPPKNTPKPPIYMFTGIIEDLGKIHSVTANGTNKTFWVESALGPELKIDQSLSHNGVCLTVEETNGNLHRVTAIEETLKKTNLGNWQPADLVNLERCMIMNSRLDGHIVQGHVDTTATCLERTDNNGSWEFRFEFPKKFSHLVIEKGSISLNGISLTIFNVKKSKFDIAIIPYTFEHTNIQSVNPGDTVNLEFDIIGKYVSRLEQVKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 2 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 3 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 4 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 5 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 6 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 110 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 114 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 125 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 126 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 127 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 128 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 129 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 130 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 131 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 139 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 141 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 142 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 143 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 144 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0 |
| Isolates | 3.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.26 |
| Nodule | 0 |
| Rhizoplane | 0.51 |
| Rhizosphere | 79.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 2 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 3 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 4 | rootH2_10288365 | 3300003320 | Unclassified | 1343 |
| 5 | rootL2_10015288 | 3300003322 | Bacteria | 6887 |
| 6 | rootL2_10214288 | 3300003322 | Unclassified | 4425 |
| 7 | rootL2_10244297 | 3300003322 | Bacteria | 1347 |
| 8 | rootH1_10260401 | 3300003323 | Bacteria | 3310 |
| 9 | rootH1_10340016 | 3300003323 | Bacteria | 1877 |
| 10 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 11 | Ga0055530_10000818 | 3300003791 | Bacteria | 25804 |
| 12 | Ga0065165_1002268 | 3300005262 | Bacteria | 16967 |
| 13 | Ga0065704_10000850 | 3300005289 | Bacteria | 11620 |
| 14 | Ga0065704_10280405 | 3300005289 | Bacteria | 918 |
| 15 | Ga0070676_10067223 | 3300005328 | Bacteria | 2143 |
| 16 | Ga0070690_100090674 | 3300005330 | Bacteria | 2013 |
| 17 | Ga0070670_100019208 | 3300005331 | Bacteria | 5860 |
| 18 | Ga0070666_10034813 | 3300005335 | Bacteria | 3338 |
| 19 | Ga0070680_100476067 | 3300005336 | Bacteria | 1067 |
| 20 | Ga0070689_100019595 | 3300005340 | Bacteria | 5005 |
| 21 | Ga0070669_100128583 | 3300005353 | Bacteria | 1941 |
| 22 | Ga0070669_100133525 | 3300005353 | Bacteria | 1907 |
| 23 | Ga0070669_100144797 | 3300005353 | Unclassified | 1835 |
| 24 | Ga0070675_100007627 | 3300005354 | Bacteria | 8372 |
| 25 | Ga0070675_100035666 | 3300005354 | Bacteria | 4043 |
| 26 | Ga0070675_100113574 | 3300005354 | Bacteria | 2294 |
| 27 | Ga0070675_100292808 | 3300005354 | Bacteria | 1433 |
| 28 | Ga0070671_100041041 | 3300005355 | Bacteria | 3845 |
| 29 | Ga0070674_100099777 | 3300005356 | Bacteria | 2113 |
| 30 | Ga0070673_100025205 | 3300005364 | Bacteria | 4373 |
| 31 | Ga0070673_100183580 | 3300005364 | Bacteria | 1792 |
| 32 | Ga0070673_101188345 | 3300005364 | Unclassified | 714 |
| 33 | Ga0070688_100129682 | 3300005365 | Bacteria | 1699 |
| 34 | Ga0070667_100019696 | 3300005367 | Bacteria | 5597 |
| 35 | Ga0070701_10300252 | 3300005438 | Bacteria | 987 |
| 36 | Ga0068867_100484976 | 3300005459 | Bacteria | 1060 |
| 37 | Ga0070685_10007412 | 3300005466 | Bacteria | 5613 |
| 38 | Ga0070685_10015603 | 3300005466 | Bacteria | 4038 |
| 39 | Ga0070686_100739342 | 3300005544 | Unclassified | 788 |
| 40 | Ga0068855_100194666 | 3300005563 | Bacteria | 2284 |
| 41 | Ga0070664_100021596 | 3300005564 | Bacteria | 5309 |
| 42 | Ga0068857_100276375 | 3300005577 | Bacteria | 1544 |
| 43 | Ga0068859_100009050 | 3300005617 | Bacteria | 10060 |
| 44 | Ga0068859_100009604 | 3300005617 | Bacteria | 9769 |
| 45 | Ga0068864_100068059 | 3300005618 | Bacteria | 3093 |
| 46 | Ga0068864_100171741 | 3300005618 | Bacteria | 1977 |
| 47 | Ga0068863_100008975 | 3300005841 | Bacteria | 9765 |
| 48 | Ga0068858_100002404 | 3300005842 | Bacteria | 18924 |
| 49 | Ga0068860_100007536 | 3300005843 | Bacteria | 10887 |
| 50 | Ga0068862_100199626 | 3300005844 | Unclassified | 1803 |
| 51 | Ga0075364_10812293 | 3300006051 | Bacteria | 637 |
| 52 | Ga0097621_100031079 | 3300006237 | Bacteria | 4234 |
| 53 | Ga0068871_100172284 | 3300006358 | Bacteria | 1856 |
| 54 | Ga0068871_100334171 | 3300006358 | Bacteria | 1337 |
| 55 | Ga0075428_101434146 | 3300006844 | Bacteria | 724 |
| 56 | Ga0097620_100009050 | 3300006931 | Bacteria | 10060 |
| 57 | Ga0097620_100009604 | 3300006931 | Bacteria | 9769 |
| 58 | Ga0105240_10000533 | 3300009093 | Bacteria | 70305 |
| 59 | Ga0105240_10002479 | 3300009093 | Bacteria | 29666 |
| 60 | Ga0111539_10022220 | 3300009094 | Bacteria | 7798 |
| 61 | Ga0111539_10207666 | 3300009094 | Bacteria | 2282 |
| 62 | Ga0111539_10358509 | 3300009094 | Unclassified | 1697 |
| 63 | Ga0111539_10367032 | 3300009094 | Bacteria | 1676 |
| 64 | Ga0105247_10913763 | 3300009101 | Bacteria | 679 |
| 65 | Ga0105243_10000004 | 3300009148 | Bacteria | 601266 |
| 66 | Ga0105248_10011739 | 3300009177 | Bacteria | 9661 |
| 67 | Ga0105237_10004250 | 3300009545 | Bacteria | 16669 |
| 68 | Ga0105237_10065815 | 3300009545 | Unclassified | 3619 |
| 69 | Ga0105239_10001651 | 3300010375 | Bacteria | 29415 |
| 70 | Ga0157373_10014755 | 3300013100 | Bacteria | 5722 |
| 71 | Ga0157370_10000562 | 3300013104 | Bacteria | 46367 |
| 72 | Ga0157370_10002039 | 3300013104 | Bacteria | 24827 |
| 73 | Ga0157370_10009780 | 3300013104 | Bacteria | 10172 |
| 74 | Ga0157370_10160584 | 3300013104 | Bacteria | 2091 |
| 75 | Ga0163162_10024274 | 3300013306 | Bacteria | 5984 |
| 76 | Ga0157372_10000644 | 3300013307 | Bacteria | 38351 |
| 77 | Ga0157375_10005563 | 3300013308 | Bacteria | 10966 |
| 78 | Ga0157375_10057863 | 3300013308 | Bacteria | 3833 |
| 79 | Ga0157380_10025713 | 3300014326 | Bacteria | 4467 |
| 80 | Ga0157380_10261198 | 3300014326 | Bacteria | 1573 |
| 81 | Ga0157380_10404099 | 3300014326 | Bacteria | 1297 |
| 82 | Ga0182008_10000272 | 3300014497 | Bacteria | 40515 |
| 83 | Ga0182008_10003116 | 3300014497 | Bacteria | 10148 |
| 84 | Ga0182008_10013629 | 3300014497 | Bacteria | 4272 |
| 85 | Ga0182008_10042241 | 3300014497 | Bacteria | 2272 |
| 86 | Ga0157377_10341890 | 3300014745 | Bacteria | 1001 |
| 87 | Ga0157377_10441541 | 3300014745 | Bacteria | 896 |
| 88 | Ga0157379_10000961 | 3300014968 | Bacteria | 23396 |
| 89 | Ga0182006_1000708 | 3300015261 | Bacteria | 23082 |
| 90 | Ga0182006_1000903 | 3300015261 | Bacteria | 19885 |
| 91 | Ga0182006_1001984 | 3300015261 | Bacteria | 11554 |
| 92 | Ga0182006_1002748 | 3300015261 | Bacteria | 9428 |
| 93 | Ga0182007_10001756 | 3300015262 | Bacteria | 11388 |
| 94 | Ga0182007_10007664 | 3300015262 | Bacteria | 4498 |
| 95 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 96 | Ga0163161_10000085 | 3300017792 | Bacteria | 93534 |
| 97 | Ga0163161_10093471 | 3300017792 | Bacteria | 2228 |
| 98 | Ga0163161_10176292 | 3300017792 | Bacteria | 1637 |
| 99 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 100 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 101 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 102 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 103 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 104 | Ga0209050_1000055 | 3300025298 | Bacteria | 339254 |
| 105 | Ga0207697_10092193 | 3300025315 | Bacteria | 1284 |
| 106 | Ga0207680_10020822 | 3300025903 | Bacteria | 3540 |
| 107 | Ga0207645_10255503 | 3300025907 | Bacteria | 1160 |
| 108 | Ga0207695_10000632 | 3300025913 | Bacteria | 70471 |
| 109 | Ga0207695_10002023 | 3300025913 | Bacteria | 31171 |
| 110 | Ga0207681_10351946 | 3300025923 | Unclassified | 1179 |
| 111 | Ga0207694_10933932 | 3300025924 | Unclassified | 734 |
| 112 | Ga0207659_10002104 | 3300025926 | Bacteria | 11789 |
| 113 | Ga0207659_10003650 | 3300025926 | Bacteria | 9270 |
| 114 | Ga0207659_10124101 | 3300025926 | Bacteria | 1983 |
| 115 | Ga0207659_10221146 | 3300025926 | Bacteria | 1523 |
| 116 | Ga0207644_10029462 | 3300025931 | Bacteria | 3809 |
| 117 | Ga0207709_10000010 | 3300025935 | Bacteria | 601305 |
| 118 | Ga0207670_10098908 | 3300025936 | Bacteria | 2080 |
| 119 | Ga0207669_10113820 | 3300025937 | Bacteria | 1820 |
| 120 | Ga0207704_10365075 | 3300025938 | Bacteria | 1128 |
| 121 | Ga0207691_10052965 | 3300025940 | Bacteria | 3706 |
| 122 | Ga0207711_10001914 | 3300025941 | Bacteria | 18908 |
| 123 | Ga0207679_10007473 | 3300025945 | Bacteria | 6935 |
| 124 | Ga0207667_10347950 | 3300025949 | Bacteria | 1512 |
| 125 | Ga0207651_10005268 | 3300025960 | Bacteria | 6617 |
| 126 | Ga0207712_10401992 | 3300025961 | Bacteria | 1151 |
| 127 | Ga0207658_10013686 | 3300025986 | Bacteria | 5548 |
| 128 | Ga0207641_10007631 | 3300026088 | Bacteria | 8994 |
| 129 | Ga0207641_10150232 | 3300026088 | Bacteria | 2109 |
| 130 | Ga0207676_10190934 | 3300026095 | Bacteria | 1802 |
| 131 | Ga0207674_10281930 | 3300026116 | Bacteria | 1610 |
| 132 | Ga0207675_101666352 | 3300026118 | Bacteria | 658 |
| 133 | Ga0207428_10105181 | 3300027907 | Bacteria | 2177 |
| 134 | Ga0207428_10593372 | 3300027907 | Bacteria | 799 |
| 135 | Ga0268265_10218804 | 3300028380 | Unclassified | 1665 |
| 136 | Ga0268264_10016082 | 3300028381 | Bacteria | 6130 |
| 137 | Ga0265318_10071772 | 3300028577 | Unclassified | 1283 |
| 138 | Ga0307515_10000681 | 3300028794 | Bacteria | 78150 |
| 139 | Ga0307515_10092916 | 3300028794 | Bacteria | 3748 |
| 140 | Ga0307408_100002221 | 3300031548 | Bacteria | 13869 |
| 141 | Ga0307408_100006767 | 3300031548 | Bacteria | 7599 |
| 142 | Ga0307514_10148394 | 3300031649 | Bacteria | 1579 |
| 143 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 144 | Ga0307409_100551929 | 3300031995 | Bacteria | 1131 |
| 145 | Ga0307416_100689315 | 3300032002 | Bacteria | 1110 |
| 146 | Ga0307414_10085973 | 3300032004 | Bacteria | 2319 |
| 147 | Ga0307414_10802601 | 3300032004 | Bacteria | 858 |
| 148 | Ga0373927_0087841 | 3300035695 | Bacteria | 2018 |
| 149 | Ga0316584_0008729 | 3300036712 | Bacteria | 6997 |
| 150 | Ga0373925_0687951 | 3300037068 | Bacteria | 843 |
| 151 | Ga0451843_0654921 | 3300041509 | Bacteria | 1251 |
| 152 | Ga0451577_0210330 | 3300042876 | Bacteria | 1757 |
| 153 | Ga0466982_0036620 | 3300044672 | Bacteria | 2948 |
| 154 | Ga0453683_0082653 | 3300044673 | Bacteria | 2012 |
| 155 | Ga0453683_0135579 | 3300044673 | Unclassified | 1552 |
| 156 | Ga0453684_0000995 | 3300044712 | Bacteria | 92458 |
| 157 | Ga0451576_0003648 | 3300045051 | Bacteria | 20898 |
| 158 | Ga0495627_123239 | 3300046453 | Bacteria | 731 |
| 159 | Ga0495638_0229312 | 3300046460 | Bacteria | 1034 |
| 160 | Ga0495607_0148492 | 3300046501 | Bacteria | 1202 |
| 161 | Ga0495610_0000113 | 3300046512 | Bacteria | 94595 |
| 162 | Ga0495609_0011013 | 3300046538 | Bacteria | 4320 |
| 163 | Ga0495625_0059041 | 3300046660 | Bacteria | 2723 |
| 164 | Ga0495636_0286932 | 3300047318 | Bacteria | 768 |
| 165 | Ga0496115_0043142 | 3300048918 | Bacteria | 3596 |
| 166 | Ga0496116_0034285 | 3300048919 | Bacteria | 3584 |
| 167 | Ga0496117_0007400 | 3300048920 | Bacteria | 10742 |
| 168 | Ga0496123_0031093 | 3300048926 | Bacteria | 3891 |
| 169 | Ga0496124_0205772 | 3300048927 | Bacteria | 1493 |
| 170 | Ga0496125_0000024 | 3300048928 | Bacteria | 442149 |
| 171 | Ga0496126_0353981 | 3300048929 | Bacteria | 1200 |
| 172 | Ga0501031_0157273 | 3300049568 | Bacteria | 1486 |
| 173 | Ga0501034_0008116 | 3300049571 | Bacteria | 11136 |
| 174 | Ga0501034_0333319 | 3300049571 | Bacteria | 1448 |
| 175 | Ga0501036_0173883 | 3300049572 | Bacteria | 1814 |
| 176 | Ga0501037_0160217 | 3300049573 | Bacteria | 1604 |
| 177 | Ga0501043_0037669 | 3300049579 | Bacteria | 3803 |
| 178 | Ga0501047_0036126 | 3300049581 | Bacteria | 4774 |
| 179 | Ga0501035_0015442 | 3300049822 | Bacteria | 7044 |
| 180 | nmdc:mga00v17_536520_c1 | 3300050491 | Bacteria | 757 |
| 181 | nmdc:mga08y16_22936_c1 | 3300050511 | Bacteria | 6589 |
| 182 | nmdc:mga08y16_353983_c1 | 3300050511 | Bacteria | 1508 |
| 183 | nmdc:mga08y16_94692_c1 | 3300050511 | Bacteria | 3111 |
| 184 | Ga0500573_0050048 | 3300053140 | Bacteria | 2404 |
| 185 | Ga0500604_0001701 | 3300053151 | Bacteria | 6169 |
| 186 | Ga0500622_0000003 | 3300053156 | Bacteria | 613483 |
| 187 | Ga0500622_0000008 | 3300053156 | Bacteria | 423636 |
| 188 | Ga0500627_0034164 | 3300053158 | Bacteria | 2154 |
| 189 | Ga0500637_0168448 | 3300053178 | Bacteria | 1260 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_101666352 | Ga0207675_1016663521 | 181 |
| 2 | 3300003322 | rootL2_10015288 | rootL2_100152886 | 183 |
| 3 | 3300044673 | Ga0453683_0135579 | Ga0453683_0135579_573_1181 | 188 |
| 4 | 3300045051 | Ga0451576_0003648 | Ga0451576_0003648_1209_1817 | 188 |
| 5 | 3300048919 | Ga0496116_0034285 | Ga0496116_0034285_2244_2834 | 188 |
| 6 | 3300042876 | Ga0451577_0210330 | Ga0451577_0210330_1125_1736 | 189 |
| 7 | 3300044673 | Ga0453683_0082653 | Ga0453683_0082653_264_875 | 189 |
| 8 | iso_pu_bacteria | 2857627736 | 2857629644 | 190 |
| 9 | 3300028794 | Ga0307515_10000681 | Ga0307515_1000068143 | 191 |
| 10 | 3300031649 | Ga0307514_10148394 | Ga0307514_101483942 | 191 |
| 11 | iso_pu_bacteria | 2739367663 | 2739647183 | 191 |
| 12 | iso_pu_bacteria | 2902048731 | 2902050301 | 191 |
| 13 | iso_pu_bacteria | 2904780799 | 2904781587 | 192 |
| 14 | iso_pu_bacteria | 2919177583 | 2919177703 | 192 |
| 15 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001545 | 194 |
| 16 | 3300003791 | Ga0055530_10000818 | Ga0055530_100008182 | 194 |
| 17 | 3300009545 | Ga0105237_10004250 | Ga0105237_100042509 | 194 |
| 18 | 3300013104 | Ga0157370_10000562 | Ga0157370_1000056219 | 194 |
| 19 | 3300013104 | Ga0157370_10002039 | Ga0157370_100020394 | 194 |
| 20 | 3300013104 | Ga0157370_10009780 | Ga0157370_100097805 | 194 |
| 21 | 3300013104 | Ga0157370_10160584 | Ga0157370_101605842 | 194 |
| 22 | 3300013308 | Ga0157375_10057863 | Ga0157375_100578632 | 194 |
| 23 | 3300014497 | Ga0182008_10000272 | Ga0182008_1000027227 | 194 |
| 24 | 3300014497 | Ga0182008_10003116 | Ga0182008_100031169 | 194 |
| 25 | 3300014497 | Ga0182008_10013629 | Ga0182008_100136295 | 194 |
| 26 | 3300014497 | Ga0182008_10042241 | Ga0182008_100422412 | 194 |
| 27 | 3300015261 | Ga0182006_1000708 | Ga0182006_100070825 | 194 |
| 28 | 3300015261 | Ga0182006_1000903 | Ga0182006_100090318 | 194 |
| 29 | 3300015261 | Ga0182006_1002748 | Ga0182006_10027486 | 194 |
| 30 | 3300015262 | Ga0182007_10001756 | Ga0182007_100017563 | 194 |
| 31 | 3300015262 | Ga0182007_10007664 | Ga0182007_100076643 | 194 |
| 32 | 3300015682 | Ga0183373_1001 | Ga0183373_1001419 | 194 |
| 33 | 3300017792 | Ga0163161_10093471 | Ga0163161_100934712 | 194 |
| 34 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008318 | 194 |
| 35 | 3300025298 | Ga0209050_1000055 | Ga0209050_100005594 | 194 |
| 36 | 3300031548 | Ga0307408_100002221 | Ga0307408_1000022215 | 194 |
| 37 | 3300031548 | Ga0307408_100006767 | Ga0307408_1000067674 | 194 |
| 38 | 3300031731 | Ga0307405_10000003 | Ga0307405_10000003341 | 194 |
| 39 | 3300031995 | Ga0307409_100551929 | Ga0307409_1005519292 | 194 |
| 40 | 3300032002 | Ga0307416_100689315 | Ga0307416_1006893151 | 194 |
| 41 | 3300036712 | Ga0316584_0008729 | Ga0316584_0008729_4888_5472 | 194 |
| 42 | 3300041509 | Ga0451843_0654921 | Ga0451843_0654921_54_638 | 194 |
| 43 | 3300046453 | Ga0495627_123239 | Ga0495627_123239_15_599 | 194 |
| 44 | 3300046512 | Ga0495610_0000113 | Ga0495610_0000113_38487_39071 | 194 |
| 45 | 3300046660 | Ga0495625_0059041 | Ga0495625_0059041_991_1575 | 194 |
| 46 | 3300053140 | Ga0500573_0050048 | Ga0500573_0050048_1166_1750 | 194 |
| 47 | 3300053151 | Ga0500604_0001701 | Ga0500604_0001701_1662_2246 | 194 |
| 48 | 3300053156 | Ga0500622_0000003 | Ga0500622_0000003_220502_221086 | 194 |
| 49 | 3300053156 | Ga0500622_0000008 | Ga0500622_0000008_14766_15350 | 194 |
| 50 | 3300053158 | Ga0500627_0034164 | Ga0500627_0034164_800_1384 | 194 |
| 51 | 3300003320 | rootH2_10288365 | rootH2_102883652 | 195 |
| 52 | 3300003322 | rootL2_10214288 | rootL2_102142883 | 195 |
| 53 | 3300003323 | rootH1_10260401 | rootH1_102604016 | 195 |
| 54 | 3300003323 | rootH1_10340016 | rootH1_103400162 | 195 |
| 55 | 3300005262 | Ga0065165_1002268 | Ga0065165_100226815 | 195 |
| 56 | 3300005328 | Ga0070676_10067223 | Ga0070676_100672232 | 195 |
| 57 | 3300005331 | Ga0070670_100019208 | Ga0070670_1000192084 | 195 |
| 58 | 3300005335 | Ga0070666_10034813 | Ga0070666_100348134 | 195 |
| 59 | 3300005336 | Ga0070680_100476067 | Ga0070680_1004760672 | 195 |
| 60 | 3300005353 | Ga0070669_100133525 | Ga0070669_1001335252 | 195 |
| 61 | 3300005353 | Ga0070669_100144797 | Ga0070669_1001447972 | 195 |
| 62 | 3300005354 | Ga0070675_100007627 | Ga0070675_1000076272 | 195 |
| 63 | 3300005354 | Ga0070675_100035666 | Ga0070675_1000356664 | 195 |
| 64 | 3300005354 | Ga0070675_100292808 | Ga0070675_1002928082 | 195 |
| 65 | 3300005355 | Ga0070671_100041041 | Ga0070671_1000410412 | 195 |
| 66 | 3300005356 | Ga0070674_100099777 | Ga0070674_1000997772 | 195 |
| 67 | 3300005364 | Ga0070673_100025205 | Ga0070673_1000252053 | 195 |
| 68 | 3300005365 | Ga0070688_100129682 | Ga0070688_1001296822 | 195 |
| 69 | 3300005367 | Ga0070667_100019696 | Ga0070667_1000196963 | 195 |
| 70 | 3300005438 | Ga0070701_10300252 | Ga0070701_103002522 | 195 |
| 71 | 3300005466 | Ga0070685_10007412 | Ga0070685_100074124 | 195 |
| 72 | 3300005466 | Ga0070685_10015603 | Ga0070685_100156034 | 195 |
| 73 | 3300005544 | Ga0070686_100739342 | Ga0070686_1007393421 | 195 |
| 74 | 3300005563 | Ga0068855_100194666 | Ga0068855_1001946662 | 195 |
| 75 | 3300005564 | Ga0070664_100021596 | Ga0070664_1000215964 | 195 |
| 76 | 3300005617 | Ga0068859_100009604 | Ga0068859_1000096043 | 195 |
| 77 | 3300005618 | Ga0068864_100171741 | Ga0068864_1001717413 | 195 |
| 78 | 3300005841 | Ga0068863_100008975 | Ga0068863_1000089753 | 195 |
| 79 | 3300005842 | Ga0068858_100002404 | Ga0068858_10000240415 | 195 |
| 80 | 3300005843 | Ga0068860_100007536 | Ga0068860_1000075367 | 195 |
| 81 | 3300005844 | Ga0068862_100199626 | Ga0068862_1001996263 | 195 |
| 82 | 3300006237 | Ga0097621_100031079 | Ga0097621_1000310793 | 195 |
| 83 | 3300006358 | Ga0068871_100172284 | Ga0068871_1001722842 | 195 |
| 84 | 3300006358 | Ga0068871_100334171 | Ga0068871_1003341714 | 195 |
| 85 | 3300006931 | Ga0097620_100009604 | Ga0097620_1000096043 | 195 |
| 86 | 3300009094 | Ga0111539_10022220 | Ga0111539_100222202 | 195 |
| 87 | 3300009094 | Ga0111539_10358509 | Ga0111539_103585092 | 195 |
| 88 | 3300009094 | Ga0111539_10367032 | Ga0111539_103670322 | 195 |
| 89 | 3300009101 | Ga0105247_10913763 | Ga0105247_109137631 | 195 |
| 90 | 3300009177 | Ga0105248_10011739 | Ga0105248_100117394 | 195 |
| 91 | 3300013100 | Ga0157373_10014755 | Ga0157373_100147557 | 195 |
| 92 | 3300013306 | Ga0163162_10024274 | Ga0163162_100242742 | 195 |
| 93 | 3300013308 | Ga0157375_10005563 | Ga0157375_100055636 | 195 |
| 94 | 3300014326 | Ga0157380_10261198 | Ga0157380_102611982 | 195 |
| 95 | 3300014326 | Ga0157380_10404099 | Ga0157380_104040992 | 195 |
| 96 | 3300014745 | Ga0157377_10441541 | Ga0157377_104415412 | 195 |
| 97 | 3300014968 | Ga0157379_10000961 | Ga0157379_1000096118 | 195 |
| 98 | 3300017792 | Ga0163161_10000085 | Ga0163161_1000008530 | 195 |
| 99 | 3300017792 | Ga0163161_10176292 | Ga0163161_101762922 | 195 |
| 100 | 3300025315 | Ga0207697_10092193 | Ga0207697_100921932 | 195 |
| 101 | 3300025903 | Ga0207680_10020822 | Ga0207680_100208222 | 195 |
| 102 | 3300025907 | Ga0207645_10255503 | Ga0207645_102555032 | 195 |
| 103 | 3300025923 | Ga0207681_10351946 | Ga0207681_103519462 | 195 |
| 104 | 3300025926 | Ga0207659_10003650 | Ga0207659_100036503 | 195 |
| 105 | 3300025926 | Ga0207659_10124101 | Ga0207659_101241012 | 195 |
| 106 | 3300025926 | Ga0207659_10221146 | Ga0207659_102211462 | 195 |
| 107 | 3300025931 | Ga0207644_10029462 | Ga0207644_100294624 | 195 |
| 108 | 3300025937 | Ga0207669_10113820 | Ga0207669_101138203 | 195 |
| 109 | 3300025938 | Ga0207704_10365075 | Ga0207704_103650752 | 195 |
| 110 | 3300025940 | Ga0207691_10052965 | Ga0207691_100529652 | 195 |
| 111 | 3300025941 | Ga0207711_10001914 | Ga0207711_1000191416 | 195 |
| 112 | 3300025945 | Ga0207679_10007473 | Ga0207679_100074734 | 195 |
| 113 | 3300025949 | Ga0207667_10347950 | Ga0207667_103479501 | 195 |
| 114 | 3300025960 | Ga0207651_10005268 | Ga0207651_100052685 | 195 |
| 115 | 3300025961 | Ga0207712_10401992 | Ga0207712_104019922 | 195 |
| 116 | 3300025986 | Ga0207658_10013686 | Ga0207658_100136863 | 195 |
| 117 | 3300026088 | Ga0207641_10007631 | Ga0207641_100076316 | 195 |
| 118 | 3300026088 | Ga0207641_10150232 | Ga0207641_101502322 | 195 |
| 119 | 3300026095 | Ga0207676_10190934 | Ga0207676_101909342 | 195 |
| 120 | 3300027907 | Ga0207428_10593372 | Ga0207428_105933721 | 195 |
| 121 | 3300028380 | Ga0268265_10218804 | Ga0268265_102188042 | 195 |
| 122 | 3300028381 | Ga0268264_10016082 | Ga0268264_100160823 | 195 |
| 123 | 3300028794 | Ga0307515_10092916 | Ga0307515_100929162 | 195 |
| 124 | 3300044672 | Ga0466982_0036620 | Ga0466982_0036620_735_1322 | 195 |
| 125 | 3300046460 | Ga0495638_0229312 | Ga0495638_0229312_65_652 | 195 |
| 126 | 3300046501 | Ga0495607_0148492 | Ga0495607_0148492_146_733 | 195 |
| 127 | 3300046538 | Ga0495609_0011013 | Ga0495609_0011013_898_1485 | 195 |
| 128 | 3300047318 | Ga0495636_0286932 | Ga0495636_0286932_166_756 | 195 |
| 129 | 3300049568 | Ga0501031_0157273 | Ga0501031_0157273_672_1259 | 195 |
| 130 | 3300049571 | Ga0501034_0008116 | Ga0501034_0008116_5442_6032 | 195 |
| 131 | 3300049571 | Ga0501034_0333319 | Ga0501034_0333319_102_689 | 195 |
| 132 | 3300049572 | Ga0501036_0173883 | Ga0501036_0173883_471_1058 | 195 |
| 133 | 3300049573 | Ga0501037_0160217 | Ga0501037_0160217_620_1207 | 195 |
| 134 | 3300049579 | Ga0501043_0037669 | Ga0501043_0037669_944_1531 | 195 |
| 135 | 3300049581 | Ga0501047_0036126 | Ga0501047_0036126_1483_2070 | 195 |
| 136 | 3300049822 | Ga0501035_0015442 | Ga0501035_0015442_5719_6306 | 195 |
| 137 | 3300050511 | nmdc:mga08y16_353983_c1 | nmdc:mga08y16_353983_c1_559_1149 | 195 |
| 138 | 3300050511 | nmdc:mga08y16_94692_c1 | nmdc:mga08y16_94692_c1_1372_1962 | 195 |
| 139 | 3300053178 | Ga0500637_0168448 | Ga0500637_0168448_630_1217 | 195 |
| 140 | 3300003322 | rootL2_10244297 | rootL2_102442972 | 196 |
| 141 | 3300005289 | Ga0065704_10000850 | Ga0065704_100008501 | 196 |
| 142 | 3300005289 | Ga0065704_10280405 | Ga0065704_102804051 | 196 |
| 143 | 3300005330 | Ga0070690_100090674 | Ga0070690_1000906743 | 196 |
| 144 | 3300005340 | Ga0070689_100019595 | Ga0070689_1000195955 | 196 |
| 145 | 3300005353 | Ga0070669_100128583 | Ga0070669_1001285832 | 196 |
| 146 | 3300005354 | Ga0070675_100113574 | Ga0070675_1001135742 | 196 |
| 147 | 3300005364 | Ga0070673_100183580 | Ga0070673_1001835802 | 196 |
| 148 | 3300005364 | Ga0070673_101188345 | Ga0070673_1011883451 | 196 |
| 149 | 3300005459 | Ga0068867_100484976 | Ga0068867_1004849762 | 196 |
| 150 | 3300005577 | Ga0068857_100276375 | Ga0068857_1002763752 | 196 |
| 151 | 3300005617 | Ga0068859_100009050 | Ga0068859_1000090503 | 196 |
| 152 | 3300005618 | Ga0068864_100068059 | Ga0068864_1000680593 | 196 |
| 153 | 3300006051 | Ga0075364_10812293 | Ga0075364_108122931 | 196 |
| 154 | 3300006844 | Ga0075428_101434146 | Ga0075428_1014341462 | 196 |
| 155 | 3300006931 | Ga0097620_100009050 | Ga0097620_1000090503 | 196 |
| 156 | 3300009093 | Ga0105240_10000533 | Ga0105240_1000053312 | 196 |
| 157 | 3300009093 | Ga0105240_10002479 | Ga0105240_1000247912 | 196 |
| 158 | 3300009094 | Ga0111539_10207666 | Ga0111539_102076662 | 196 |
| 159 | 3300009148 | Ga0105243_10000004 | Ga0105243_10000004341 | 196 |
| 160 | 3300009545 | Ga0105237_10065815 | Ga0105237_100658153 | 196 |
| 161 | 3300013307 | Ga0157372_10000644 | Ga0157372_100006447 | 196 |
| 162 | 3300014326 | Ga0157380_10025713 | Ga0157380_100257132 | 196 |
| 163 | 3300014745 | Ga0157377_10341890 | Ga0157377_103418902 | 196 |
| 164 | 3300025913 | Ga0207695_10000632 | Ga0207695_1000063240 | 196 |
| 165 | 3300025924 | Ga0207694_10933932 | Ga0207694_109339321 | 196 |
| 166 | 3300025926 | Ga0207659_10002104 | Ga0207659_100021042 | 196 |
| 167 | 3300025935 | Ga0207709_10000010 | Ga0207709_10000010343 | 196 |
| 168 | 3300025936 | Ga0207670_10098908 | Ga0207670_100989082 | 196 |
| 169 | 3300026116 | Ga0207674_10281930 | Ga0207674_102819302 | 196 |
| 170 | 3300027907 | Ga0207428_10105181 | Ga0207428_101051812 | 196 |
| 171 | 3300028577 | Ga0265318_10071772 | Ga0265318_100717722 | 196 |
| 172 | 3300032004 | Ga0307414_10085973 | Ga0307414_100859732 | 196 |
| 173 | 3300032004 | Ga0307414_10802601 | Ga0307414_108026012 | 196 |
| 174 | 3300035695 | Ga0373927_0087841 | Ga0373927_0087841_611_1201 | 196 |
| 175 | 3300037068 | Ga0373925_0687951 | Ga0373925_0687951_36_641 | 196 |
| 176 | 3300048918 | Ga0496115_0043142 | Ga0496115_0043142_79_669 | 196 |
| 177 | 3300048928 | Ga0496125_0000024 | Ga0496125_0000024_236553_237143 | 196 |
| 178 | 3300048929 | Ga0496126_0353981 | Ga0496126_0353981_371_961 | 196 |
| 179 | 3300050491 | nmdc:mga00v17_536520_c1 | nmdc:mga00v17_536520_c1_11_601 | 196 |
| 180 | 3300050511 | nmdc:mga08y16_22936_c1 | nmdc:mga08y16_22936_c1_928_1524 | 196 |
| 181 | 3300015261 | Ga0182006_1001984 | Ga0182006_10019849 | 205 |
| 182 | 3300044712 | Ga0453684_0000995 | Ga0453684_0000995_1475_2185 | 210 |
| 183 | 3300048920 | Ga0496117_0007400 | Ga0496117_0007400_6072_6752 | 210 |
| 184 | 3300048926 | Ga0496123_0031093 | Ga0496123_0031093_2951_3631 | 210 |
| 185 | 3300048927 | Ga0496124_0205772 | Ga0496124_0205772_87_767 | 210 |
| 186 | 3300025913 | Ga0207695_10002023 | Ga0207695_1000202317 | 212 |
| 187 | iso_pu_bacteria | 2721755487 | 2722727726 | 214 |
| 188 | 3300010375 | Ga0105239_10001651 | Ga0105239_1000165126 | 217 |
| 189 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001233 | 218 |
| 190 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001567 | 218 |
| 191 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001456 | 218 |
| 192 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002932 | 218 |
| 193 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002932 | 218 |
| 194 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004258 | 218 |
| 195 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006258 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.924 | 23 | 107 |
| 3ddy-assembly1.cif.gz_A | structure of lumazine protein, an optical transponder of luminescent bacteria | 0.9072 | 23 | 204 |
| 3ddy-assembly1.cif.gz_A | structure of lumazine protein, an optical transponder of luminescent bacteria | 0.8973 | 23 | 204 |
| 3a3b-assembly1.cif.gz_B | crystal structure of lump complexed with flavin mononucleotide | 0.8963 | 23 | 204 |
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.8935 | 23 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fxuC02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9335 | 122 | 212 | 2.40.30.20 |
| af_Q2FXG0_1_88_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9251 | 23 | 108 | 2.40.30.20 |
| af_P0AFU8_1_89_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9166 | 23 | 108 | 2.40.30.20 |
| 4fxuC02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9143 | 122 | 212 | 2.40.30.20 |
| 3a3bB02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9137 | 28 | 108 | 2.40.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D0JIU0-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.92 | 38 | 217 |
GO:0004746
GO:0009231 |
| AF-A0A1Q7HAC6-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9159 | 30 | 200 |
GO:0004746
GO:0009231 |
| AF-A0A7V3ZUH0-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9104 | 24 | 195 |
GO:0004746
GO:0009231 |
| AF-A0A1Z8UNC1-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9098 | 23 | 198 |
GO:0004746
GO:0009231 |
| AF-A0A359MEC7-F1-model_v4 | deleted | 0.9077 | 49 | 218 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar