F300188

General Info

Members Datasets Scaffolds Average Seq Length
195 144 189 197

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10002023|Ga0207695_1000202317
Length 225
Sequence MVNFVESKDRANSRKTNPPPKNTPKPPIYMFTGIIEDLGKIHSVTANGTNKTFWVESALGPELKIDQSLSHNGVCLTVEETNGNLHRVTAIEETLKKTNLGNWQPADLVNLERCMIMNSRLDGHIVQGHVDTTATCLERTDNNGSWEFRFEFPKKFSHLVIEKGSISLNGISLTIFNVKKSKFDIAIIPYTFEHTNIQSVNPGDTVNLEFDIIGKYVSRLEQVKN

Samples

Sample ID Description Type Environment
1 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
2 2739367663 Pedobacter sp. YR510 Isolate Unclassified
3 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
4 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
5 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
6 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 0.51
Rhizosphere 79.49
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000001 3300002774 Bacteria 1318726
2 JGI25151J46595_10000001 3300003187 Bacteria 887211
3 JGI25153J46596_10000001 3300003215 Bacteria 748985
4 rootH2_10288365 3300003320 Unclassified 1343
5 rootL2_10015288 3300003322 Bacteria 6887
6 rootL2_10214288 3300003322 Unclassified 4425
7 rootL2_10244297 3300003322 Bacteria 1347
8 rootH1_10260401 3300003323 Bacteria 3310
9 rootH1_10340016 3300003323 Bacteria 1877
10 Ga0055536_1000001 3300003781 Bacteria 630663
11 Ga0055530_10000818 3300003791 Bacteria 25804
12 Ga0065165_1002268 3300005262 Bacteria 16967
13 Ga0065704_10000850 3300005289 Bacteria 11620
14 Ga0065704_10280405 3300005289 Bacteria 918
15 Ga0070676_10067223 3300005328 Bacteria 2143
16 Ga0070690_100090674 3300005330 Bacteria 2013
17 Ga0070670_100019208 3300005331 Bacteria 5860
18 Ga0070666_10034813 3300005335 Bacteria 3338
19 Ga0070680_100476067 3300005336 Bacteria 1067
20 Ga0070689_100019595 3300005340 Bacteria 5005
21 Ga0070669_100128583 3300005353 Bacteria 1941
22 Ga0070669_100133525 3300005353 Bacteria 1907
23 Ga0070669_100144797 3300005353 Unclassified 1835
24 Ga0070675_100007627 3300005354 Bacteria 8372
25 Ga0070675_100035666 3300005354 Bacteria 4043
26 Ga0070675_100113574 3300005354 Bacteria 2294
27 Ga0070675_100292808 3300005354 Bacteria 1433
28 Ga0070671_100041041 3300005355 Bacteria 3845
29 Ga0070674_100099777 3300005356 Bacteria 2113
30 Ga0070673_100025205 3300005364 Bacteria 4373
31 Ga0070673_100183580 3300005364 Bacteria 1792
32 Ga0070673_101188345 3300005364 Unclassified 714
33 Ga0070688_100129682 3300005365 Bacteria 1699
34 Ga0070667_100019696 3300005367 Bacteria 5597
35 Ga0070701_10300252 3300005438 Bacteria 987
36 Ga0068867_100484976 3300005459 Bacteria 1060
37 Ga0070685_10007412 3300005466 Bacteria 5613
38 Ga0070685_10015603 3300005466 Bacteria 4038
39 Ga0070686_100739342 3300005544 Unclassified 788
40 Ga0068855_100194666 3300005563 Bacteria 2284
41 Ga0070664_100021596 3300005564 Bacteria 5309
42 Ga0068857_100276375 3300005577 Bacteria 1544
43 Ga0068859_100009050 3300005617 Bacteria 10060
44 Ga0068859_100009604 3300005617 Bacteria 9769
45 Ga0068864_100068059 3300005618 Bacteria 3093
46 Ga0068864_100171741 3300005618 Bacteria 1977
47 Ga0068863_100008975 3300005841 Bacteria 9765
48 Ga0068858_100002404 3300005842 Bacteria 18924
49 Ga0068860_100007536 3300005843 Bacteria 10887
50 Ga0068862_100199626 3300005844 Unclassified 1803
51 Ga0075364_10812293 3300006051 Bacteria 637
52 Ga0097621_100031079 3300006237 Bacteria 4234
53 Ga0068871_100172284 3300006358 Bacteria 1856
54 Ga0068871_100334171 3300006358 Bacteria 1337
55 Ga0075428_101434146 3300006844 Bacteria 724
56 Ga0097620_100009050 3300006931 Bacteria 10060
57 Ga0097620_100009604 3300006931 Bacteria 9769
58 Ga0105240_10000533 3300009093 Bacteria 70305
59 Ga0105240_10002479 3300009093 Bacteria 29666
60 Ga0111539_10022220 3300009094 Bacteria 7798
61 Ga0111539_10207666 3300009094 Bacteria 2282
62 Ga0111539_10358509 3300009094 Unclassified 1697
63 Ga0111539_10367032 3300009094 Bacteria 1676
64 Ga0105247_10913763 3300009101 Bacteria 679
65 Ga0105243_10000004 3300009148 Bacteria 601266
66 Ga0105248_10011739 3300009177 Bacteria 9661
67 Ga0105237_10004250 3300009545 Bacteria 16669
68 Ga0105237_10065815 3300009545 Unclassified 3619
69 Ga0105239_10001651 3300010375 Bacteria 29415
70 Ga0157373_10014755 3300013100 Bacteria 5722
71 Ga0157370_10000562 3300013104 Bacteria 46367
72 Ga0157370_10002039 3300013104 Bacteria 24827
73 Ga0157370_10009780 3300013104 Bacteria 10172
74 Ga0157370_10160584 3300013104 Bacteria 2091
75 Ga0163162_10024274 3300013306 Bacteria 5984
76 Ga0157372_10000644 3300013307 Bacteria 38351
77 Ga0157375_10005563 3300013308 Bacteria 10966
78 Ga0157375_10057863 3300013308 Bacteria 3833
79 Ga0157380_10025713 3300014326 Bacteria 4467
80 Ga0157380_10261198 3300014326 Bacteria 1573
81 Ga0157380_10404099 3300014326 Bacteria 1297
82 Ga0182008_10000272 3300014497 Bacteria 40515
83 Ga0182008_10003116 3300014497 Bacteria 10148
84 Ga0182008_10013629 3300014497 Bacteria 4272
85 Ga0182008_10042241 3300014497 Bacteria 2272
86 Ga0157377_10341890 3300014745 Bacteria 1001
87 Ga0157377_10441541 3300014745 Bacteria 896
88 Ga0157379_10000961 3300014968 Bacteria 23396
89 Ga0182006_1000708 3300015261 Bacteria 23082
90 Ga0182006_1000903 3300015261 Bacteria 19885
91 Ga0182006_1001984 3300015261 Bacteria 11554
92 Ga0182006_1002748 3300015261 Bacteria 9428
93 Ga0182007_10001756 3300015262 Bacteria 11388
94 Ga0182007_10007664 3300015262 Bacteria 4498
95 Ga0183373_1001 3300015682 Bacteria 1410374
96 Ga0163161_10000085 3300017792 Bacteria 93534
97 Ga0163161_10093471 3300017792 Bacteria 2228
98 Ga0163161_10176292 3300017792 Bacteria 1637
99 Ga0207425_1000002 3300025245 Bacteria 1362590
100 Ga0209129_1000002 3300025258 Bacteria 1359086
101 Ga0209676_1000008 3300025292 Bacteria 991778
102 Ga0209025_1000004 3300025294 Bacteria 1361782
103 Ga0209758_1000006 3300025297 Bacteria 1359562
104 Ga0209050_1000055 3300025298 Bacteria 339254
105 Ga0207697_10092193 3300025315 Bacteria 1284
106 Ga0207680_10020822 3300025903 Bacteria 3540
107 Ga0207645_10255503 3300025907 Bacteria 1160
108 Ga0207695_10000632 3300025913 Bacteria 70471
109 Ga0207695_10002023 3300025913 Bacteria 31171
110 Ga0207681_10351946 3300025923 Unclassified 1179
111 Ga0207694_10933932 3300025924 Unclassified 734
112 Ga0207659_10002104 3300025926 Bacteria 11789
113 Ga0207659_10003650 3300025926 Bacteria 9270
114 Ga0207659_10124101 3300025926 Bacteria 1983
115 Ga0207659_10221146 3300025926 Bacteria 1523
116 Ga0207644_10029462 3300025931 Bacteria 3809
117 Ga0207709_10000010 3300025935 Bacteria 601305
118 Ga0207670_10098908 3300025936 Bacteria 2080
119 Ga0207669_10113820 3300025937 Bacteria 1820
120 Ga0207704_10365075 3300025938 Bacteria 1128
121 Ga0207691_10052965 3300025940 Bacteria 3706
122 Ga0207711_10001914 3300025941 Bacteria 18908
123 Ga0207679_10007473 3300025945 Bacteria 6935
124 Ga0207667_10347950 3300025949 Bacteria 1512
125 Ga0207651_10005268 3300025960 Bacteria 6617
126 Ga0207712_10401992 3300025961 Bacteria 1151
127 Ga0207658_10013686 3300025986 Bacteria 5548
128 Ga0207641_10007631 3300026088 Bacteria 8994
129 Ga0207641_10150232 3300026088 Bacteria 2109
130 Ga0207676_10190934 3300026095 Bacteria 1802
131 Ga0207674_10281930 3300026116 Bacteria 1610
132 Ga0207675_101666352 3300026118 Bacteria 658
133 Ga0207428_10105181 3300027907 Bacteria 2177
134 Ga0207428_10593372 3300027907 Bacteria 799
135 Ga0268265_10218804 3300028380 Unclassified 1665
136 Ga0268264_10016082 3300028381 Bacteria 6130
137 Ga0265318_10071772 3300028577 Unclassified 1283
138 Ga0307515_10000681 3300028794 Bacteria 78150
139 Ga0307515_10092916 3300028794 Bacteria 3748
140 Ga0307408_100002221 3300031548 Bacteria 13869
141 Ga0307408_100006767 3300031548 Bacteria 7599
142 Ga0307514_10148394 3300031649 Bacteria 1579
143 Ga0307405_10000003 3300031731 Bacteria 569064
144 Ga0307409_100551929 3300031995 Bacteria 1131
145 Ga0307416_100689315 3300032002 Bacteria 1110
146 Ga0307414_10085973 3300032004 Bacteria 2319
147 Ga0307414_10802601 3300032004 Bacteria 858
148 Ga0373927_0087841 3300035695 Bacteria 2018
149 Ga0316584_0008729 3300036712 Bacteria 6997
150 Ga0373925_0687951 3300037068 Bacteria 843
151 Ga0451843_0654921 3300041509 Bacteria 1251
152 Ga0451577_0210330 3300042876 Bacteria 1757
153 Ga0466982_0036620 3300044672 Bacteria 2948
154 Ga0453683_0082653 3300044673 Bacteria 2012
155 Ga0453683_0135579 3300044673 Unclassified 1552
156 Ga0453684_0000995 3300044712 Bacteria 92458
157 Ga0451576_0003648 3300045051 Bacteria 20898
158 Ga0495627_123239 3300046453 Bacteria 731
159 Ga0495638_0229312 3300046460 Bacteria 1034
160 Ga0495607_0148492 3300046501 Bacteria 1202
161 Ga0495610_0000113 3300046512 Bacteria 94595
162 Ga0495609_0011013 3300046538 Bacteria 4320
163 Ga0495625_0059041 3300046660 Bacteria 2723
164 Ga0495636_0286932 3300047318 Bacteria 768
165 Ga0496115_0043142 3300048918 Bacteria 3596
166 Ga0496116_0034285 3300048919 Bacteria 3584
167 Ga0496117_0007400 3300048920 Bacteria 10742
168 Ga0496123_0031093 3300048926 Bacteria 3891
169 Ga0496124_0205772 3300048927 Bacteria 1493
170 Ga0496125_0000024 3300048928 Bacteria 442149
171 Ga0496126_0353981 3300048929 Bacteria 1200
172 Ga0501031_0157273 3300049568 Bacteria 1486
173 Ga0501034_0008116 3300049571 Bacteria 11136
174 Ga0501034_0333319 3300049571 Bacteria 1448
175 Ga0501036_0173883 3300049572 Bacteria 1814
176 Ga0501037_0160217 3300049573 Bacteria 1604
177 Ga0501043_0037669 3300049579 Bacteria 3803
178 Ga0501047_0036126 3300049581 Bacteria 4774
179 Ga0501035_0015442 3300049822 Bacteria 7044
180 nmdc:mga00v17_536520_c1 3300050491 Bacteria 757
181 nmdc:mga08y16_22936_c1 3300050511 Bacteria 6589
182 nmdc:mga08y16_353983_c1 3300050511 Bacteria 1508
183 nmdc:mga08y16_94692_c1 3300050511 Bacteria 3111
184 Ga0500573_0050048 3300053140 Bacteria 2404
185 Ga0500604_0001701 3300053151 Bacteria 6169
186 Ga0500622_0000003 3300053156 Bacteria 613483
187 Ga0500622_0000008 3300053156 Bacteria 423636
188 Ga0500627_0034164 3300053158 Bacteria 2154
189 Ga0500637_0168448 3300053178 Bacteria 1260

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_101666352 Ga0207675_1016663521 181
2 3300003322 rootL2_10015288 rootL2_100152886 183
3 3300044673 Ga0453683_0135579 Ga0453683_0135579_573_1181 188
4 3300045051 Ga0451576_0003648 Ga0451576_0003648_1209_1817 188
5 3300048919 Ga0496116_0034285 Ga0496116_0034285_2244_2834 188
6 3300042876 Ga0451577_0210330 Ga0451577_0210330_1125_1736 189
7 3300044673 Ga0453683_0082653 Ga0453683_0082653_264_875 189
8 iso_pu_bacteria 2857627736 2857629644 190
9 3300028794 Ga0307515_10000681 Ga0307515_1000068143 191
10 3300031649 Ga0307514_10148394 Ga0307514_101483942 191
11 iso_pu_bacteria 2739367663 2739647183 191
12 iso_pu_bacteria 2902048731 2902050301 191
13 iso_pu_bacteria 2904780799 2904781587 192
14 iso_pu_bacteria 2919177583 2919177703 192
15 3300003781 Ga0055536_1000001 Ga0055536_1000001545 194
16 3300003791 Ga0055530_10000818 Ga0055530_100008182 194
17 3300009545 Ga0105237_10004250 Ga0105237_100042509 194
18 3300013104 Ga0157370_10000562 Ga0157370_1000056219 194
19 3300013104 Ga0157370_10002039 Ga0157370_100020394 194
20 3300013104 Ga0157370_10009780 Ga0157370_100097805 194
21 3300013104 Ga0157370_10160584 Ga0157370_101605842 194
22 3300013308 Ga0157375_10057863 Ga0157375_100578632 194
23 3300014497 Ga0182008_10000272 Ga0182008_1000027227 194
24 3300014497 Ga0182008_10003116 Ga0182008_100031169 194
25 3300014497 Ga0182008_10013629 Ga0182008_100136295 194
26 3300014497 Ga0182008_10042241 Ga0182008_100422412 194
27 3300015261 Ga0182006_1000708 Ga0182006_100070825 194
28 3300015261 Ga0182006_1000903 Ga0182006_100090318 194
29 3300015261 Ga0182006_1002748 Ga0182006_10027486 194
30 3300015262 Ga0182007_10001756 Ga0182007_100017563 194
31 3300015262 Ga0182007_10007664 Ga0182007_100076643 194
32 3300015682 Ga0183373_1001 Ga0183373_1001419 194
33 3300017792 Ga0163161_10093471 Ga0163161_100934712 194
34 3300025292 Ga0209676_1000008 Ga0209676_1000008318 194
35 3300025298 Ga0209050_1000055 Ga0209050_100005594 194
36 3300031548 Ga0307408_100002221 Ga0307408_1000022215 194
37 3300031548 Ga0307408_100006767 Ga0307408_1000067674 194
38 3300031731 Ga0307405_10000003 Ga0307405_10000003341 194
39 3300031995 Ga0307409_100551929 Ga0307409_1005519292 194
40 3300032002 Ga0307416_100689315 Ga0307416_1006893151 194
41 3300036712 Ga0316584_0008729 Ga0316584_0008729_4888_5472 194
42 3300041509 Ga0451843_0654921 Ga0451843_0654921_54_638 194
43 3300046453 Ga0495627_123239 Ga0495627_123239_15_599 194
44 3300046512 Ga0495610_0000113 Ga0495610_0000113_38487_39071 194
45 3300046660 Ga0495625_0059041 Ga0495625_0059041_991_1575 194
46 3300053140 Ga0500573_0050048 Ga0500573_0050048_1166_1750 194
47 3300053151 Ga0500604_0001701 Ga0500604_0001701_1662_2246 194
48 3300053156 Ga0500622_0000003 Ga0500622_0000003_220502_221086 194
49 3300053156 Ga0500622_0000008 Ga0500622_0000008_14766_15350 194
50 3300053158 Ga0500627_0034164 Ga0500627_0034164_800_1384 194
51 3300003320 rootH2_10288365 rootH2_102883652 195
52 3300003322 rootL2_10214288 rootL2_102142883 195
53 3300003323 rootH1_10260401 rootH1_102604016 195
54 3300003323 rootH1_10340016 rootH1_103400162 195
55 3300005262 Ga0065165_1002268 Ga0065165_100226815 195
56 3300005328 Ga0070676_10067223 Ga0070676_100672232 195
57 3300005331 Ga0070670_100019208 Ga0070670_1000192084 195
58 3300005335 Ga0070666_10034813 Ga0070666_100348134 195
59 3300005336 Ga0070680_100476067 Ga0070680_1004760672 195
60 3300005353 Ga0070669_100133525 Ga0070669_1001335252 195
61 3300005353 Ga0070669_100144797 Ga0070669_1001447972 195
62 3300005354 Ga0070675_100007627 Ga0070675_1000076272 195
63 3300005354 Ga0070675_100035666 Ga0070675_1000356664 195
64 3300005354 Ga0070675_100292808 Ga0070675_1002928082 195
65 3300005355 Ga0070671_100041041 Ga0070671_1000410412 195
66 3300005356 Ga0070674_100099777 Ga0070674_1000997772 195
67 3300005364 Ga0070673_100025205 Ga0070673_1000252053 195
68 3300005365 Ga0070688_100129682 Ga0070688_1001296822 195
69 3300005367 Ga0070667_100019696 Ga0070667_1000196963 195
70 3300005438 Ga0070701_10300252 Ga0070701_103002522 195
71 3300005466 Ga0070685_10007412 Ga0070685_100074124 195
72 3300005466 Ga0070685_10015603 Ga0070685_100156034 195
73 3300005544 Ga0070686_100739342 Ga0070686_1007393421 195
74 3300005563 Ga0068855_100194666 Ga0068855_1001946662 195
75 3300005564 Ga0070664_100021596 Ga0070664_1000215964 195
76 3300005617 Ga0068859_100009604 Ga0068859_1000096043 195
77 3300005618 Ga0068864_100171741 Ga0068864_1001717413 195
78 3300005841 Ga0068863_100008975 Ga0068863_1000089753 195
79 3300005842 Ga0068858_100002404 Ga0068858_10000240415 195
80 3300005843 Ga0068860_100007536 Ga0068860_1000075367 195
81 3300005844 Ga0068862_100199626 Ga0068862_1001996263 195
82 3300006237 Ga0097621_100031079 Ga0097621_1000310793 195
83 3300006358 Ga0068871_100172284 Ga0068871_1001722842 195
84 3300006358 Ga0068871_100334171 Ga0068871_1003341714 195
85 3300006931 Ga0097620_100009604 Ga0097620_1000096043 195
86 3300009094 Ga0111539_10022220 Ga0111539_100222202 195
87 3300009094 Ga0111539_10358509 Ga0111539_103585092 195
88 3300009094 Ga0111539_10367032 Ga0111539_103670322 195
89 3300009101 Ga0105247_10913763 Ga0105247_109137631 195
90 3300009177 Ga0105248_10011739 Ga0105248_100117394 195
91 3300013100 Ga0157373_10014755 Ga0157373_100147557 195
92 3300013306 Ga0163162_10024274 Ga0163162_100242742 195
93 3300013308 Ga0157375_10005563 Ga0157375_100055636 195
94 3300014326 Ga0157380_10261198 Ga0157380_102611982 195
95 3300014326 Ga0157380_10404099 Ga0157380_104040992 195
96 3300014745 Ga0157377_10441541 Ga0157377_104415412 195
97 3300014968 Ga0157379_10000961 Ga0157379_1000096118 195
98 3300017792 Ga0163161_10000085 Ga0163161_1000008530 195
99 3300017792 Ga0163161_10176292 Ga0163161_101762922 195
100 3300025315 Ga0207697_10092193 Ga0207697_100921932 195
101 3300025903 Ga0207680_10020822 Ga0207680_100208222 195
102 3300025907 Ga0207645_10255503 Ga0207645_102555032 195
103 3300025923 Ga0207681_10351946 Ga0207681_103519462 195
104 3300025926 Ga0207659_10003650 Ga0207659_100036503 195
105 3300025926 Ga0207659_10124101 Ga0207659_101241012 195
106 3300025926 Ga0207659_10221146 Ga0207659_102211462 195
107 3300025931 Ga0207644_10029462 Ga0207644_100294624 195
108 3300025937 Ga0207669_10113820 Ga0207669_101138203 195
109 3300025938 Ga0207704_10365075 Ga0207704_103650752 195
110 3300025940 Ga0207691_10052965 Ga0207691_100529652 195
111 3300025941 Ga0207711_10001914 Ga0207711_1000191416 195
112 3300025945 Ga0207679_10007473 Ga0207679_100074734 195
113 3300025949 Ga0207667_10347950 Ga0207667_103479501 195
114 3300025960 Ga0207651_10005268 Ga0207651_100052685 195
115 3300025961 Ga0207712_10401992 Ga0207712_104019922 195
116 3300025986 Ga0207658_10013686 Ga0207658_100136863 195
117 3300026088 Ga0207641_10007631 Ga0207641_100076316 195
118 3300026088 Ga0207641_10150232 Ga0207641_101502322 195
119 3300026095 Ga0207676_10190934 Ga0207676_101909342 195
120 3300027907 Ga0207428_10593372 Ga0207428_105933721 195
121 3300028380 Ga0268265_10218804 Ga0268265_102188042 195
122 3300028381 Ga0268264_10016082 Ga0268264_100160823 195
123 3300028794 Ga0307515_10092916 Ga0307515_100929162 195
124 3300044672 Ga0466982_0036620 Ga0466982_0036620_735_1322 195
125 3300046460 Ga0495638_0229312 Ga0495638_0229312_65_652 195
126 3300046501 Ga0495607_0148492 Ga0495607_0148492_146_733 195
127 3300046538 Ga0495609_0011013 Ga0495609_0011013_898_1485 195
128 3300047318 Ga0495636_0286932 Ga0495636_0286932_166_756 195
129 3300049568 Ga0501031_0157273 Ga0501031_0157273_672_1259 195
130 3300049571 Ga0501034_0008116 Ga0501034_0008116_5442_6032 195
131 3300049571 Ga0501034_0333319 Ga0501034_0333319_102_689 195
132 3300049572 Ga0501036_0173883 Ga0501036_0173883_471_1058 195
133 3300049573 Ga0501037_0160217 Ga0501037_0160217_620_1207 195
134 3300049579 Ga0501043_0037669 Ga0501043_0037669_944_1531 195
135 3300049581 Ga0501047_0036126 Ga0501047_0036126_1483_2070 195
136 3300049822 Ga0501035_0015442 Ga0501035_0015442_5719_6306 195
137 3300050511 nmdc:mga08y16_353983_c1 nmdc:mga08y16_353983_c1_559_1149 195
138 3300050511 nmdc:mga08y16_94692_c1 nmdc:mga08y16_94692_c1_1372_1962 195
139 3300053178 Ga0500637_0168448 Ga0500637_0168448_630_1217 195
140 3300003322 rootL2_10244297 rootL2_102442972 196
141 3300005289 Ga0065704_10000850 Ga0065704_100008501 196
142 3300005289 Ga0065704_10280405 Ga0065704_102804051 196
143 3300005330 Ga0070690_100090674 Ga0070690_1000906743 196
144 3300005340 Ga0070689_100019595 Ga0070689_1000195955 196
145 3300005353 Ga0070669_100128583 Ga0070669_1001285832 196
146 3300005354 Ga0070675_100113574 Ga0070675_1001135742 196
147 3300005364 Ga0070673_100183580 Ga0070673_1001835802 196
148 3300005364 Ga0070673_101188345 Ga0070673_1011883451 196
149 3300005459 Ga0068867_100484976 Ga0068867_1004849762 196
150 3300005577 Ga0068857_100276375 Ga0068857_1002763752 196
151 3300005617 Ga0068859_100009050 Ga0068859_1000090503 196
152 3300005618 Ga0068864_100068059 Ga0068864_1000680593 196
153 3300006051 Ga0075364_10812293 Ga0075364_108122931 196
154 3300006844 Ga0075428_101434146 Ga0075428_1014341462 196
155 3300006931 Ga0097620_100009050 Ga0097620_1000090503 196
156 3300009093 Ga0105240_10000533 Ga0105240_1000053312 196
157 3300009093 Ga0105240_10002479 Ga0105240_1000247912 196
158 3300009094 Ga0111539_10207666 Ga0111539_102076662 196
159 3300009148 Ga0105243_10000004 Ga0105243_10000004341 196
160 3300009545 Ga0105237_10065815 Ga0105237_100658153 196
161 3300013307 Ga0157372_10000644 Ga0157372_100006447 196
162 3300014326 Ga0157380_10025713 Ga0157380_100257132 196
163 3300014745 Ga0157377_10341890 Ga0157377_103418902 196
164 3300025913 Ga0207695_10000632 Ga0207695_1000063240 196
165 3300025924 Ga0207694_10933932 Ga0207694_109339321 196
166 3300025926 Ga0207659_10002104 Ga0207659_100021042 196
167 3300025935 Ga0207709_10000010 Ga0207709_10000010343 196
168 3300025936 Ga0207670_10098908 Ga0207670_100989082 196
169 3300026116 Ga0207674_10281930 Ga0207674_102819302 196
170 3300027907 Ga0207428_10105181 Ga0207428_101051812 196
171 3300028577 Ga0265318_10071772 Ga0265318_100717722 196
172 3300032004 Ga0307414_10085973 Ga0307414_100859732 196
173 3300032004 Ga0307414_10802601 Ga0307414_108026012 196
174 3300035695 Ga0373927_0087841 Ga0373927_0087841_611_1201 196
175 3300037068 Ga0373925_0687951 Ga0373925_0687951_36_641 196
176 3300048918 Ga0496115_0043142 Ga0496115_0043142_79_669 196
177 3300048928 Ga0496125_0000024 Ga0496125_0000024_236553_237143 196
178 3300048929 Ga0496126_0353981 Ga0496126_0353981_371_961 196
179 3300050491 nmdc:mga00v17_536520_c1 nmdc:mga00v17_536520_c1_11_601 196
180 3300050511 nmdc:mga08y16_22936_c1 nmdc:mga08y16_22936_c1_928_1524 196
181 3300015261 Ga0182006_1001984 Ga0182006_10019849 205
182 3300044712 Ga0453684_0000995 Ga0453684_0000995_1475_2185 210
183 3300048920 Ga0496117_0007400 Ga0496117_0007400_6072_6752 210
184 3300048926 Ga0496123_0031093 Ga0496123_0031093_2951_3631 210
185 3300048927 Ga0496124_0205772 Ga0496124_0205772_87_767 210
186 3300025913 Ga0207695_10002023 Ga0207695_1000202317 212
187 iso_pu_bacteria 2721755487 2722727726 214
188 3300010375 Ga0105239_10001651 Ga0105239_1000165126 217
189 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001233 218
190 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001567 218
191 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001456 218
192 3300025245 Ga0207425_1000002 Ga0207425_1000002932 218
193 3300025258 Ga0209129_1000002 Ga0209129_1000002932 218
194 3300025294 Ga0209025_1000004 Ga0209025_1000004258 218
195 3300025297 Ga0209758_1000006 Ga0209758_1000006258 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

127

211

0.98

PF00677

Lum_binding

Lumazine binding domain

32

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.924 23 107
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.9072 23 204
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.8973 23 204
3a3b-assembly1.cif.gz_B crystal structure of lump complexed with flavin mononucleotide 0.8963 23 204
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.8935 23 107
ID Description Score Start End Superfamily
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9335 122 212 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9251 23 108 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9166 23 108 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9143 122 212 2.40.30.20
3a3bB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9137 28 108 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A5D0JIU0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.92 38 217 GO:0004746
GO:0009231
AF-A0A1Q7HAC6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9159 30 200 GO:0004746
GO:0009231
AF-A0A7V3ZUH0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9104 24 195 GO:0004746
GO:0009231
AF-A0A1Z8UNC1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9098 23 198 GO:0004746
GO:0009231
AF-A0A359MEC7-F1-model_v4 deleted 0.9077 49 218

Feature Viewer

pLDDT pTM Quality
81.62 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map