F300066

General Info

Members Datasets Scaffolds Average Seq Length
195 134 195 127

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10006245|Ga0105239_100062457
Length 154
Sequence MKIMVLHPTKKLNGRNIFLSYKETKSNMTTSTNNKVMTTQEVAFRFNELAKQEKWFEIQDELFSDNVRSIDPPGSPYFGYAEGKVPVRKKGEEFVSKVEAFHGAHTTEPVLAGNHFAVGREMDITVQGFGRIQIKEIMLYEVKDGKIVLEQFFY

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
124 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
125 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
126 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
127 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
128 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
129 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 1.03
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10053943 3300001979 Bacteria 1138
2 rootH2_10124054 3300003320 Bacteria 14745
3 rootH2_10148392 3300003320 Bacteria 5085
4 rootL2_10016536 3300003322 Bacteria 1813
5 rootL2_10076567 3300003322 Bacteria 1568
6 rootL2_10161131 3300003322 Unclassified 1207
7 rootH1_10121882 3300003323 Bacteria 11580
8 Ga0055530_10045048 3300003791 Bacteria 1054
9 Ga0070683_100000831 3300005329 Bacteria 22877
10 Ga0070683_100135217 3300005329 Bacteria 2334
11 Ga0070690_100178605 3300005330 Bacteria 1466
12 Ga0070670_100876697 3300005331 Unclassified 813
13 Ga0070670_101210918 3300005331 Unclassified 690
14 Ga0068869_100007650 3300005334 Bacteria 6919
15 Ga0070666_10062680 3300005335 Bacteria 2520
16 Ga0070682_100018610 3300005337 Bacteria 4065
17 Ga0070682_101621019 3300005337 Bacteria 560
18 Ga0068868_100021774 3300005338 Bacteria 4831
19 Ga0070691_10123604 3300005341 Bacteria 1305
20 Ga0070661_100094425 3300005344 Unclassified 2217
21 Ga0070668_100266066 3300005347 Bacteria 1427
22 Ga0070674_100368482 3300005356 Bacteria 1165
23 Ga0070673_100029079 3300005364 Unclassified 4118
24 Ga0070673_100731465 3300005364 Bacteria 910
25 Ga0070667_100419995 3300005367 Bacteria 1219
26 Ga0070662_101041205 3300005457 Bacteria 701
27 Ga0068867_100821222 3300005459 Bacteria 831
28 Ga0070706_101299278 3300005467 Bacteria 667
29 Ga0070698_100028406 3300005471 Bacteria 5809
30 Ga0070684_100002578 3300005535 Bacteria 13385
31 Ga0068853_100149441 3300005539 Bacteria 2102
32 Ga0070672_100710124 3300005543 Bacteria 881
33 Ga0070665_100000063 3300005548 Bacteria 218300
34 Ga0070665_100889847 3300005548 Bacteria 903
35 Ga0068855_100003396 3300005563 Bacteria 19494
36 Ga0068855_100062150 3300005563 Unclassified 4361
37 Ga0068855_100170367 3300005563 Bacteria 2466
38 Ga0070664_100054440 3300005564 Unclassified 3394
39 Ga0068857_100034595 3300005577 Unclassified 4468
40 Ga0068857_100039377 3300005577 Unclassified 4186
41 Ga0068857_100173044 3300005577 Bacteria 1963
42 Ga0068854_100035877 3300005578 Unclassified 3473
43 Ga0068854_100168033 3300005578 Bacteria 1704
44 Ga0068854_100643903 3300005578 Bacteria 909
45 Ga0068856_100022849 3300005614 Bacteria 6082
46 Ga0068856_102284253 3300005614 Unclassified 549
47 Ga0068852_100010913 3300005616 Bacteria 6808
48 Ga0068852_100042147 3300005616 Bacteria 3863
49 Ga0068852_102692953 3300005616 Bacteria 516
50 Ga0068859_100030669 3300005617 Bacteria 5395
51 Ga0068859_100166340 3300005617 Unclassified 2285
52 Ga0068861_101936783 3300005719 Unclassified 587
53 Ga0068851_10322578 3300005834 Bacteria 893
54 Ga0068851_10326709 3300005834 Bacteria 887
55 Ga0068851_10866230 3300005834 Bacteria 564
56 Ga0068863_100068068 3300005841 Bacteria 3368
57 Ga0068863_100843304 3300005841 Bacteria 915
58 Ga0068863_102217765 3300005841 Bacteria 559
59 Ga0068858_100969647 3300005842 Bacteria 833
60 Ga0081539_10001586 3300005985 Bacteria 37565
61 Ga0068865_100299507 3300006881 Bacteria 1286
62 Ga0097620_100030668 3300006931 Bacteria 5395
63 Ga0097620_100166351 3300006931 Unclassified 2285
64 Ga0105240_10030724 3300009093 Bacteria 6977
65 Ga0105240_10052057 3300009093 Bacteria 5148
66 Ga0105240_10148986 3300009093 Unclassified 2789
67 Ga0105240_11141247 3300009093 Bacteria 828
68 Ga0105240_11688334 3300009093 Bacteria 661
69 Ga0111539_11157479 3300009094 Bacteria 899
70 Ga0105247_11212398 3300009101 Bacteria 601
71 Ga0105241_10013202 3300009174 Bacteria 6055
72 Ga0105241_10204747 3300009174 Bacteria 1650
73 Ga0105241_11048992 3300009174 Bacteria 765
74 Ga0105241_11548257 3300009174 Unclassified 640
75 Ga0105237_10024391 3300009545 Bacteria 6187
76 Ga0105237_10148146 3300009545 Bacteria 2343
77 Ga0105237_10348435 3300009545 Bacteria 1485
78 Ga0105238_10016811 3300009551 Bacteria 7417
79 Ga0105249_10018807 3300009553 Bacteria 6158
80 Ga0105239_10006245 3300010375 Bacteria 13854
81 Ga0105239_10013703 3300010375 Bacteria 9004
82 Ga0105239_11351477 3300010375 Unclassified 822
83 Ga0157373_10012068 3300013100 Bacteria 6350
84 Ga0157373_10491753 3300013100 Bacteria 886
85 Ga0157371_10033739 3300013102 Bacteria 3675
86 Ga0157371_10065853 3300013102 Bacteria 2566
87 Ga0157371_11098822 3300013102 Bacteria 610
88 Ga0157370_10012666 3300013104 Bacteria 8733
89 Ga0157369_10010087 3300013105 Bacteria 10786
90 Ga0157369_10263186 3300013105 Bacteria 1798
91 Ga0157369_11215555 3300013105 Bacteria 769
92 Ga0157374_10097558 3300013296 Bacteria 2813
93 Ga0157378_10975302 3300013297 Unclassified 881
94 Ga0157378_11462310 3300013297 Bacteria 727
95 Ga0163162_10239136 3300013306 Bacteria 1947
96 Ga0163162_11023773 3300013306 Bacteria 934
97 Ga0157372_10080623 3300013307 Bacteria 3683
98 Ga0157372_10094949 3300013307 Unclassified 3397
99 Ga0157372_10394507 3300013307 Bacteria 1613
100 Ga0157372_12099016 3300013307 Unclassified 649
101 Ga0157375_10631736 3300013308 Bacteria 1228
102 Ga0163163_10080578 3300014325 Bacteria 3256
103 Ga0157380_10011723 3300014326 Bacteria 6339
104 Ga0157377_10009154 3300014745 Bacteria 4850
105 Ga0157376_11234761 3300014969 Bacteria 776
106 Ga0163161_10326010 3300017792 Bacteria 1215
107 Ga0206356_11667275 3300020070 Bacteria 997
108 Ga0206356_11819916 3300020070 Bacteria 609
109 Ga0209050_1000990 3300025298 Bacteria 36024
110 Ga0209257_1091973 3300025304 Bacteria 756
111 Ga0207656_10230553 3300025321 Bacteria 902
112 Ga0207656_10544057 3300025321 Bacteria 591
113 Ga0207656_10731722 3300025321 Bacteria 507
114 Ga0207682_10150085 3300025893 Bacteria 1051
115 Ga0207647_10012528 3300025904 Bacteria 5899
116 Ga0207647_10452160 3300025904 Bacteria 720
117 Ga0207654_10009905 3300025911 Unclassified 4846
118 Ga0207654_10112763 3300025911 Bacteria 1694
119 Ga0207654_10387682 3300025911 Bacteria 969
120 Ga0207654_11056971 3300025911 Bacteria 591
121 Ga0207707_10404305 3300025912 Bacteria 1172
122 Ga0207695_10090763 3300025913 Bacteria 3070
123 Ga0207695_10092594 3300025913 Bacteria 3033
124 Ga0207671_10274310 3300025914 Unclassified 1329
125 Ga0207657_10897135 3300025919 Bacteria 683
126 Ga0207649_10339678 3300025920 Bacteria 1108
127 Ga0207652_10287846 3300025921 Bacteria 1482
128 Ga0207681_10505225 3300025923 Unclassified 990
129 Ga0207694_10127738 3300025924 Unclassified 2035
130 Ga0207650_11208835 3300025925 Unclassified 643
131 Ga0207706_10031587 3300025933 Bacteria 4717
132 Ga0207669_10297262 3300025937 Bacteria 1225
133 Ga0207689_10006043 3300025942 Bacteria 10704
134 Ga0207661_10022435 3300025944 Bacteria 4755
135 Ga0207661_11515773 3300025944 Bacteria 614
136 Ga0207679_10013746 3300025945 Bacteria 5308
137 Ga0207667_10011048 3300025949 Bacteria 10518
138 Ga0207667_10032121 3300025949 Bacteria 5659
139 Ga0207667_10074684 3300025949 Unclassified 3521
140 Ga0207651_10176098 3300025960 Bacteria 1692
141 Ga0207712_10006518 3300025961 Bacteria 7364
142 Ga0207640_11533353 3300025981 Bacteria 599
143 Ga0207658_10683308 3300025986 Bacteria 927
144 Ga0207677_10013175 3300026023 Unclassified 4782
145 Ga0207703_10096321 3300026035 Unclassified 2498
146 Ga0207639_10067824 3300026041 Bacteria 2777
147 Ga0207678_10070022 3300026067 Unclassified 3008
148 Ga0207702_10052737 3300026078 Unclassified 3442
149 Ga0207702_10241815 3300026078 Bacteria 1691
150 Ga0207702_11912906 3300026078 Bacteria 584
151 Ga0207641_10830422 3300026088 Bacteria 915
152 Ga0207648_10269492 3300026089 Bacteria 1521
153 Ga0207648_12028044 3300026089 Bacteria 536
154 Ga0207674_10004429 3300026116 Bacteria 16885
155 Ga0207674_10009094 3300026116 Bacteria 11402
156 Ga0207674_10487336 3300026116 Bacteria 1192
157 Ga0207675_101402114 3300026118 Unclassified 719
158 Ga0207698_10057781 3300026142 Bacteria 3003
159 Ga0207698_12703273 3300026142 Bacteria 505
160 Ga0268266_10000057 3300028379 Bacteria 284777
161 Ga0307515_10000193 3300028794 Bacteria 148602
162 Ga0307410_10014190 3300031852 Bacteria 4679
163 Ga0307407_10115186 3300031903 Bacteria 1694
164 Ga0307409_100673040 3300031995 Bacteria 1031
165 Ga0307411_10471046 3300032005 Unclassified 1055
166 Ga0373935_0156764 3300035692 Bacteria 1549
167 Ga0439441_022524 3300042001 Bacteria 1172
168 Ga0466969_0000930 3300044656 Bacteria 15813
169 Ga0466966_0000186 3300044684 Bacteria 41305
170 Ga0466961_0316555 3300044693 Bacteria 952
171 Ga0466964_0118511 3300044706 Bacteria 1190
172 Ga0466968_0158031 3300044735 Unclassified 1045
173 Ga0466957_0000723 3300044842 Bacteria 16946
174 Ga0466959_0000025 3300045049 Bacteria 120128
175 Ga0495658_0410422 3300046683 Bacteria 864
176 Ga0495672_0016209 3300047320 Bacteria 5034
177 Ga0495686_0011001 3300047472 Bacteria 6400
178 Ga0496109_0206152 3300048912 Bacteria 1849
179 Ga0496112_1357218 3300048915 Bacteria 626
180 Ga0501034_0032585 3300049571 Bacteria 5291
181 Ga0501043_0140290 3300049579 Unclassified 1893
182 Ga0501046_0300712 3300049580 Unclassified 1172
183 Ga0501047_0191401 3300049581 Unclassified 1909
184 Ga0501202_032383 3300049652 Bacteria 1097
185 Ga0501207_069624 3300049654 Unclassified 659
186 Ga0501233_171814 3300049668 Unclassified 616
187 Ga0501249_181632 3300049679 Unclassified 544
188 Ga0501250_025146 3300049680 Unclassified 797
189 Ga0501271_041951 3300049768 Unclassified 598
190 Ga0501275_083287 3300049772 Unclassified 522
191 Ga0501035_1296299 3300049822 Unclassified 562
192 Ga0500616_0335646 3300053153 Bacteria 618
193 Ga0500636_0491865 3300053177 Unclassified 544
194 Ga0500637_0243922 3300053178 Bacteria 1006
195 Ga0466962_0227713 3300061719 Bacteria 913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_11688334 Ga0105240_116883342 123
2 3300005578 Ga0068854_100168033 Ga0068854_1001680331 124
3 3300005719 Ga0068861_101936783 Ga0068861_1019367831 124
4 3300005841 Ga0068863_100843304 Ga0068863_1008433041 124
5 3300026088 Ga0207641_10830422 Ga0207641_108304221 124
6 3300047472 Ga0495686_0011001 Ga0495686_0011001_2644_3018 124
7 3300003322 rootL2_10076567 rootL2_100765672 125
8 3300005364 Ga0070673_100731465 Ga0070673_1007314652 125
9 3300005457 Ga0070662_101041205 Ga0070662_1010412051 125
10 3300005467 Ga0070706_101299278 Ga0070706_1012992781 125
11 3300005471 Ga0070698_100028406 Ga0070698_1000284063 125
12 3300005548 Ga0070665_100889847 Ga0070665_1008898471 125
13 3300005563 Ga0068855_100062150 Ga0068855_1000621505 125
14 3300005834 Ga0068851_10322578 Ga0068851_103225782 125
15 3300005841 Ga0068863_102217765 Ga0068863_1022177651 125
16 3300009093 Ga0105240_10052057 Ga0105240_100520573 125
17 3300009093 Ga0105240_11141247 Ga0105240_111412471 125
18 3300009174 Ga0105241_11548257 Ga0105241_115482571 125
19 3300013102 Ga0157371_10033739 Ga0157371_100337394 125
20 3300013102 Ga0157371_11098822 Ga0157371_110988221 125
21 3300013306 Ga0163162_11023773 Ga0163162_110237733 125
22 3300013307 Ga0157372_10394507 Ga0157372_103945073 125
23 3300014969 Ga0157376_11234761 Ga0157376_112347612 125
24 3300025913 Ga0207695_10092594 Ga0207695_100925943 125
25 3300025949 Ga0207667_10074684 Ga0207667_100746842 125
26 3300026089 Ga0207648_12028044 Ga0207648_120280441 125
27 3300026118 Ga0207675_101402114 Ga0207675_1014021142 125
28 3300028794 Ga0307515_10000193 Ga0307515_1000019323 125
29 3300031852 Ga0307410_10014190 Ga0307410_100141903 125
30 3300031903 Ga0307407_10115186 Ga0307407_101151862 125
31 3300031995 Ga0307409_100673040 Ga0307409_1006730402 125
32 3300032005 Ga0307411_10471046 Ga0307411_104710462 125
33 3300044842 Ga0466957_0000723 Ga0466957_0000723_6466_6843 125
34 3300046683 Ga0495658_0410422 Ga0495658_0410422_59_436 125
35 3300049571 Ga0501034_0032585 Ga0501034_0032585_301_678 125
36 3300049579 Ga0501043_0140290 Ga0501043_0140290_1071_1448 125
37 3300049580 Ga0501046_0300712 Ga0501046_0300712_216_593 125
38 3300049581 Ga0501047_0191401 Ga0501047_0191401_1050_1427 125
39 3300061719 Ga0466962_0227713 Ga0466962_0227713_32_409 125
40 3300003320 rootH2_10124054 rootH2_1012405411 126
41 3300003791 Ga0055530_10045048 Ga0055530_100450482 126
42 3300005331 Ga0070670_101210918 Ga0070670_1012109181 126
43 3300005347 Ga0070668_100266066 Ga0070668_1002660662 126
44 3300005367 Ga0070667_100419995 Ga0070667_1004199952 126
45 3300005548 Ga0070665_100000063 Ga0070665_100000063116 126
46 3300005563 Ga0068855_100170367 Ga0068855_1001703672 126
47 3300005577 Ga0068857_100034595 Ga0068857_1000345954 126
48 3300005578 Ga0068854_100035877 Ga0068854_1000358772 126
49 3300005578 Ga0068854_100643903 Ga0068854_1006439032 126
50 3300005614 Ga0068856_102284253 Ga0068856_1022842531 126
51 3300005616 Ga0068852_100010913 Ga0068852_1000109132 126
52 3300005616 Ga0068852_100042147 Ga0068852_1000421472 126
53 3300009093 Ga0105240_10030724 Ga0105240_100307242 126
54 3300009174 Ga0105241_10204747 Ga0105241_102047472 126
55 3300009545 Ga0105237_10024391 Ga0105237_100243916 126
56 3300009551 Ga0105238_10016811 Ga0105238_100168113 126
57 3300013100 Ga0157373_10491753 Ga0157373_104917532 126
58 3300013104 Ga0157370_10012666 Ga0157370_1001266610 126
59 3300013105 Ga0157369_10263186 Ga0157369_102631862 126
60 3300013297 Ga0157378_11462310 Ga0157378_114623102 126
61 3300013307 Ga0157372_10094949 Ga0157372_100949491 126
62 3300020070 Ga0206356_11819916 Ga0206356_118199162 126
63 3300025298 Ga0209050_1000990 Ga0209050_100099016 126
64 3300025304 Ga0209257_1091973 Ga0209257_10919732 126
65 3300025321 Ga0207656_10544057 Ga0207656_105440571 126
66 3300025904 Ga0207647_10012528 Ga0207647_100125283 126
67 3300025911 Ga0207654_10112763 Ga0207654_101127632 126
68 3300025911 Ga0207654_11056971 Ga0207654_110569711 126
69 3300025913 Ga0207695_10090763 Ga0207695_100907632 126
70 3300025914 Ga0207671_10274310 Ga0207671_102743102 126
71 3300025924 Ga0207694_10127738 Ga0207694_101277382 126
72 3300025925 Ga0207650_11208835 Ga0207650_112088351 126
73 3300025949 Ga0207667_10032121 Ga0207667_100321213 126
74 3300025981 Ga0207640_11533353 Ga0207640_115333532 126
75 3300025986 Ga0207658_10683308 Ga0207658_106833082 126
76 3300026078 Ga0207702_11912906 Ga0207702_119129062 126
77 3300026116 Ga0207674_10009094 Ga0207674_100090948 126
78 3300026142 Ga0207698_10057781 Ga0207698_100577812 126
79 3300028379 Ga0268266_10000057 Ga0268266_10000057175 126
80 3300035692 Ga0373935_0156764 Ga0373935_0156764_761_1141 126
81 3300047320 Ga0495672_0016209 Ga0495672_0016209_845_1225 126
82 3300049654 Ga0501207_069624 Ga0501207_069624_115_495 126
83 3300049822 Ga0501035_1296299 Ga0501035_1296299_115_495 126
84 3300053153 Ga0500616_0335646 Ga0500616_0335646_126_506 126
85 3300001979 JGI24740J21852_10053943 JGI24740J21852_100539432 127
86 3300003320 rootH2_10148392 rootH2_101483927 127
87 3300003322 rootL2_10016536 rootL2_100165362 127
88 3300003322 rootL2_10161131 rootL2_101611311 127
89 3300003323 rootH1_10121882 rootH1_101218827 127
90 3300005329 Ga0070683_100000831 Ga0070683_10000083114 127
91 3300005329 Ga0070683_100135217 Ga0070683_1001352172 127
92 3300005330 Ga0070690_100178605 Ga0070690_1001786051 127
93 3300005331 Ga0070670_100876697 Ga0070670_1008766972 127
94 3300005334 Ga0068869_100007650 Ga0068869_1000076507 127
95 3300005335 Ga0070666_10062680 Ga0070666_100626803 127
96 3300005337 Ga0070682_100018610 Ga0070682_1000186102 127
97 3300005337 Ga0070682_101621019 Ga0070682_1016210191 127
98 3300005338 Ga0068868_100021774 Ga0068868_1000217745 127
99 3300005341 Ga0070691_10123604 Ga0070691_101236042 127
100 3300005344 Ga0070661_100094425 Ga0070661_1000944252 127
101 3300005356 Ga0070674_100368482 Ga0070674_1003684821 127
102 3300005364 Ga0070673_100029079 Ga0070673_1000290797 127
103 3300005459 Ga0068867_100821222 Ga0068867_1008212222 127
104 3300005535 Ga0070684_100002578 Ga0070684_1000025788 127
105 3300005539 Ga0068853_100149441 Ga0068853_1001494412 127
106 3300005543 Ga0070672_100710124 Ga0070672_1007101242 127
107 3300005563 Ga0068855_100003396 Ga0068855_10000339612 127
108 3300005564 Ga0070664_100054440 Ga0070664_1000544403 127
109 3300005577 Ga0068857_100039377 Ga0068857_1000393773 127
110 3300005577 Ga0068857_100173044 Ga0068857_1001730442 127
111 3300005614 Ga0068856_100022849 Ga0068856_1000228496 127
112 3300005616 Ga0068852_102692953 Ga0068852_1026929531 127
113 3300005617 Ga0068859_100030669 Ga0068859_1000306697 127
114 3300005617 Ga0068859_100166340 Ga0068859_1001663404 127
115 3300005834 Ga0068851_10326709 Ga0068851_103267092 127
116 3300005834 Ga0068851_10866230 Ga0068851_108662301 127
117 3300005841 Ga0068863_100068068 Ga0068863_1000680682 127
118 3300005842 Ga0068858_100969647 Ga0068858_1009696471 127
119 3300005985 Ga0081539_10001586 Ga0081539_1000158618 127
120 3300006881 Ga0068865_100299507 Ga0068865_1002995071 127
121 3300006931 Ga0097620_100030668 Ga0097620_1000306681 127
122 3300006931 Ga0097620_100166351 Ga0097620_1001663512 127
123 3300009093 Ga0105240_10148986 Ga0105240_101489862 127
124 3300009094 Ga0111539_11157479 Ga0111539_111574791 127
125 3300009101 Ga0105247_11212398 Ga0105247_112123981 127
126 3300009174 Ga0105241_10013202 Ga0105241_100132027 127
127 3300009174 Ga0105241_11048992 Ga0105241_110489921 127
128 3300009545 Ga0105237_10148146 Ga0105237_101481464 127
129 3300009545 Ga0105237_10348435 Ga0105237_103484353 127
130 3300009553 Ga0105249_10018807 Ga0105249_100188078 127
131 3300010375 Ga0105239_10006245 Ga0105239_100062457 127
132 3300010375 Ga0105239_10013703 Ga0105239_100137035 127
133 3300010375 Ga0105239_11351477 Ga0105239_113514772 127
134 3300013100 Ga0157373_10012068 Ga0157373_100120685 127
135 3300013102 Ga0157371_10065853 Ga0157371_100658532 127
136 3300013105 Ga0157369_10010087 Ga0157369_100100877 127
137 3300013105 Ga0157369_11215555 Ga0157369_112155551 127
138 3300013296 Ga0157374_10097558 Ga0157374_100975582 127
139 3300013297 Ga0157378_10975302 Ga0157378_109753021 127
140 3300013306 Ga0163162_10239136 Ga0163162_102391364 127
141 3300013307 Ga0157372_10080623 Ga0157372_100806233 127
142 3300013307 Ga0157372_12099016 Ga0157372_120990162 127
143 3300013308 Ga0157375_10631736 Ga0157375_106317361 127
144 3300014325 Ga0163163_10080578 Ga0163163_100805783 127
145 3300014326 Ga0157380_10011723 Ga0157380_100117234 127
146 3300014745 Ga0157377_10009154 Ga0157377_100091547 127
147 3300017792 Ga0163161_10326010 Ga0163161_103260101 127
148 3300020070 Ga0206356_11667275 Ga0206356_116672752 127
149 3300025321 Ga0207656_10230553 Ga0207656_102305532 127
150 3300025321 Ga0207656_10731722 Ga0207656_107317221 127
151 3300025893 Ga0207682_10150085 Ga0207682_101500851 127
152 3300025904 Ga0207647_10452160 Ga0207647_104521601 127
153 3300025911 Ga0207654_10009905 Ga0207654_100099053 127
154 3300025911 Ga0207654_10387682 Ga0207654_103876822 127
155 3300025912 Ga0207707_10404305 Ga0207707_104043052 127
156 3300025919 Ga0207657_10897135 Ga0207657_108971351 127
157 3300025920 Ga0207649_10339678 Ga0207649_103396782 127
158 3300025921 Ga0207652_10287846 Ga0207652_102878462 127
159 3300025923 Ga0207681_10505225 Ga0207681_105052252 127
160 3300025933 Ga0207706_10031587 Ga0207706_100315875 127
161 3300025937 Ga0207669_10297262 Ga0207669_102972622 127
162 3300025942 Ga0207689_10006043 Ga0207689_1000604311 127
163 3300025944 Ga0207661_10022435 Ga0207661_100224355 127
164 3300025944 Ga0207661_11515773 Ga0207661_115157731 127
165 3300025945 Ga0207679_10013746 Ga0207679_100137466 127
166 3300025949 Ga0207667_10011048 Ga0207667_100110489 127
167 3300025960 Ga0207651_10176098 Ga0207651_101760981 127
168 3300025961 Ga0207712_10006518 Ga0207712_100065187 127
169 3300026023 Ga0207677_10013175 Ga0207677_100131752 127
170 3300026035 Ga0207703_10096321 Ga0207703_100963214 127
171 3300026041 Ga0207639_10067824 Ga0207639_100678241 127
172 3300026067 Ga0207678_10070022 Ga0207678_100700225 127
173 3300026078 Ga0207702_10052737 Ga0207702_100527372 127
174 3300026078 Ga0207702_10241815 Ga0207702_102418153 127
175 3300026089 Ga0207648_10269492 Ga0207648_102694922 127
176 3300026116 Ga0207674_10004429 Ga0207674_1000442916 127
177 3300026116 Ga0207674_10487336 Ga0207674_104873361 127
178 3300026142 Ga0207698_12703273 Ga0207698_127032731 127
179 3300042001 Ga0439441_022524 Ga0439441_022524_89_472 127
180 3300044656 Ga0466969_0000930 Ga0466969_0000930_6822_7205 127
181 3300044684 Ga0466966_0000186 Ga0466966_0000186_530_913 127
182 3300044693 Ga0466961_0316555 Ga0466961_0316555_300_683 127
183 3300044706 Ga0466964_0118511 Ga0466964_0118511_317_700 127
184 3300044735 Ga0466968_0158031 Ga0466968_0158031_12_395 127
185 3300045049 Ga0466959_0000025 Ga0466959_0000025_104010_104393 127
186 3300048912 Ga0496109_0206152 Ga0496109_0206152_623_1006 127
187 3300048915 Ga0496112_1357218 Ga0496112_1357218_113_496 127
188 3300049652 Ga0501202_032383 Ga0501202_032383_666_1073 127
189 3300049668 Ga0501233_171814 Ga0501233_171814_160_567 127
190 3300049679 Ga0501249_181632 Ga0501249_181632_53_460 127
191 3300049680 Ga0501250_025146 Ga0501250_025146_287_694 127
192 3300049768 Ga0501271_041951 Ga0501271_041951_133_540 127
193 3300049772 Ga0501275_083287 Ga0501275_083287_37_444 127
194 3300053177 Ga0500636_0491865 Ga0500636_0491865_55_441 127
195 3300053178 Ga0500637_0243922 Ga0500637_0243922_216_602 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20409

SnoaL_5

SnoaL-like domain

37

154

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9438 10 127
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9361 10 127
5u35-assembly1.cif.gz_B crystal structure of a de novo designed protein with curved beta-sheet 0.8761 12 126
5tph-assembly1.cif.gz_A crystal structure of a de novo designed protein homodimer with curved beta-sheet 0.8702 12 125
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.8327 10 126
ID Description Score Start End Superfamily
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9462 11 127 3.10.450.50
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9381 11 127 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8975 14 126 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8821 14 126 3.10.450.50
af_Q55DR3_11_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8495 12 126 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7K0EKB8-F1-model_v4 SRPBCC domain-containing protein 0.9954 9 127
AF-A0A537K939-F1-model_v4 Nuclear transport factor 2 family protein 0.9907 10 127
AF-A0A7W1EDJ0-F1-model_v4 Nuclear transport factor 2 family protein 0.9856 10 127
AF-A0A537K939-F1-model_v4 Nuclear transport factor 2 family protein 0.9825 10 127
AF-A0A3D2SBG4-F1-model_v4 SnoaL-like domain-containing protein 0.9809 10 127

Feature Viewer

pLDDT pTM Quality
93.99 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map