F300064

General Info

Members Datasets Scaffolds Average Seq Length
195 162 390 206

Family's Representative Sequence

Representative Sequence 3300009987|Ga0105030_104810|Ga0105030_1048101
Length 240
Sequence LSRGIVHLRVRVLATFPIPEALKRFDPKRTLRTTFGTMQAVEAVVFDVGGVLLDWDPEYLYRRLIPDAAERRRFLTEVCTPEWNQMQDAGRSWAEAVEDLVARFPDHAELIAAFHTRWEETVAGPIEPTVDILRELRSSGIPVYALTNFSAEKWEIAKQRWSFLGDFDGEVVSGKERVVKPNPRIYEILIERYALDPRHTLYTDDLSENIEQARRLGFQVELFTSPEGLRKRLEDSGLIQ

Samples

Sample ID Description Type Environment
1 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
162 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 1.54
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 2.05
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105030_104810 3300009987 Bacteria 1144
2 JGI24740J21852_10072713 3300001979 Bacteria 917
3 JGI24739J22299_10004230 3300001989 Bacteria 5495
4 JGI24739J22299_10091510 3300001989 Bacteria 926
5 JGI24737J22298_10017484 3300001990 Bacteria 2309
6 Ga0070670_100013672 3300005331 Bacteria 6956
7 Ga0070670_100268700 3300005331 Bacteria 1488
8 Ga0068869_100602774 3300005334 Unclassified 928
9 Ga0070666_10662394 3300005335 Bacteria 764
10 Ga0070682_100173793 3300005337 Bacteria 1499
11 Ga0068868_100228903 3300005338 Bacteria 1559
12 Ga0068868_100539948 3300005338 Bacteria 1026
13 Ga0070668_100095276 3300005347 Bacteria 2351
14 Ga0070671_100031222 3300005355 Bacteria 4399
15 Ga0070674_100811017 3300005356 Unclassified 809
16 Ga0070673_100047102 3300005364 Bacteria 3352
17 Ga0070673_100853362 3300005364 Bacteria 843
18 Ga0070688_100927569 3300005365 Bacteria 688
19 Ga0070667_100025216 3300005367 Bacteria 4943
20 Ga0070709_10071119 3300005434 Bacteria 2245
21 Ga0070714_100047626 3300005435 Bacteria 3643
22 Ga0070714_100072470 3300005435 Bacteria 2982
23 Ga0070714_100248212 3300005435 Bacteria 1645
24 Ga0070714_100554570 3300005435 Bacteria 1100
25 Ga0070714_100562255 3300005435 Bacteria 1093
26 Ga0070713_100067314 3300005436 Bacteria 3015
27 Ga0070713_100553169 3300005436 Unclassified 1090
28 Ga0070710_10161014 3300005437 Bacteria 1392
29 Ga0070694_100353369 3300005444 Bacteria 1139
30 Ga0070708_100167715 3300005445 Unclassified 2049
31 Ga0070663_100254763 3300005455 Bacteria 1390
32 Ga0068867_100527600 3300005459 Bacteria 1019
33 Ga0070685_10575240 3300005466 Bacteria 807
34 Ga0070706_100528264 3300005467 Bacteria 1097
35 Ga0070706_100630146 3300005467 Bacteria 996
36 Ga0070707_100129341 3300005468 Bacteria 2455
37 Ga0070707_100770657 3300005468 Bacteria 926
38 Ga0070698_100155422 3300005471 Bacteria 2233
39 Ga0070698_101167170 3300005471 Unclassified 719
40 Ga0070697_100518797 3300005536 Bacteria 1043
41 Ga0070672_100026939 3300005543 Bacteria 4284
42 Ga0070672_100450236 3300005543 Bacteria 1109
43 Ga0070672_100617374 3300005543 Bacteria 945
44 Ga0070665_100209317 3300005548 Bacteria 1951
45 Ga0068854_100661290 3300005578 Bacteria 898
46 Ga0068856_100237279 3300005614 Bacteria 1839
47 Ga0070702_100265296 3300005615 Bacteria 1171
48 Ga0068858_100105873 3300005842 Bacteria 2625
49 Ga0068860_100239096 3300005843 Bacteria 1766
50 Ga0068860_101256186 3300005843 Bacteria 761
51 Ga0081538_10036778 3300005981 Bacteria 3188
52 Ga0070717_10031040 3300006028 Bacteria 4296
53 Ga0075365_10121293 3300006038 Bacteria 1803
54 Ga0075364_10405091 3300006051 Bacteria 931
55 Ga0070716_100026698 3300006173 Bacteria 3095
56 Ga0070712_100052890 3300006175 Bacteria 2834
57 Ga0070712_100134012 3300006175 Unclassified 1881
58 Ga0097621_100116360 3300006237 Bacteria 2264
59 Ga0075428_100092117 3300006844 Bacteria 3305
60 Ga0075430_100036197 3300006846 Bacteria 4185
61 Ga0075431_100028690 3300006847 Bacteria 5722
62 Ga0075429_100002210 3300006880 Bacteria 16280
63 Ga0114129_10236690 3300009147 Bacteria 2456
64 Ga0105248_10003393 3300009177 Bacteria 17692
65 Ga0105028_102043 3300009993 Bacteria 2119
66 Ga0105239_10907026 3300010375 Bacteria 1012
67 Ga0163162_10092446 3300013306 Bacteria 3109
68 Ga0157372_10302407 3300013307 Bacteria 1861
69 Ga0157375_10083107 3300013308 Bacteria 3246
70 Ga0197907_10337270 3300020069 Bacteria 1628
71 Ga0206355_1015136 3300020076 Unclassified 1336
72 Ga0213876_10008893 3300021384 Bacteria 5417
73 Ga0213875_10000941 3300021388 Bacteria 20900
74 Ga0224712_10004398 3300022467 Bacteria 3797
75 Ga0224572_1010628 3300024225 Bacteria 1735
76 Ga0207692_10020700 3300025898 Bacteria 2997
77 Ga0207647_10022176 3300025904 Bacteria 4224
78 Ga0207699_10249133 3300025906 Bacteria 1223
79 Ga0207645_10620899 3300025907 Bacteria 734
80 Ga0207643_10496907 3300025908 Bacteria 779
81 Ga0207684_10502405 3300025910 Bacteria 1039
82 Ga0207693_10005447 3300025915 Bacteria 10613
83 Ga0207693_10071584 3300025915 Bacteria 2714
84 Ga0207646_10026413 3300025922 Bacteria 5299
85 Ga0207650_10895991 3300025925 Bacteria 753
86 Ga0207700_10089704 3300025928 Bacteria 2424
87 Ga0207700_10145102 3300025928 Bacteria 1955
88 Ga0207664_10207224 3300025929 Bacteria 1695
89 Ga0207664_10473088 3300025929 Bacteria 1120
90 Ga0207644_10029544 3300025931 Bacteria 3803
91 Ga0207706_10055625 3300025933 Bacteria 3489
92 Ga0207670_10369709 3300025936 Bacteria 1139
93 Ga0207665_10052443 3300025939 Bacteria 2748
94 Ga0207691_10009400 3300025940 Bacteria 9388
95 Ga0207691_10493983 3300025940 Bacteria 1039
96 Ga0207711_10030040 3300025941 Bacteria 4583
97 Ga0207689_10580558 3300025942 Unclassified 942
98 Ga0207668_10077091 3300025972 Bacteria 2402
99 Ga0207658_10151505 3300025986 Bacteria 1890
100 Ga0207677_10471798 3300026023 Bacteria 1079
101 Ga0207674_10636492 3300026116 Bacteria 1030
102 Ga0207698_10904254 3300026142 Bacteria 890
103 Ga0268264_10909648 3300028381 Bacteria 883
104 Ga0265337_1001241 3300028556 Bacteria 12907
105 Ga0265326_10008076 3300028558 Bacteria 3191
106 Ga0265334_10007525 3300028573 Bacteria 4668
107 Ga0265318_10034277 3300028577 Bacteria 1958
108 Ga0265323_10023204 3300028653 Bacteria 2367
109 Ga0265336_10011935 3300028666 Bacteria 2938
110 Ga0265338_10000530 3300028800 Bacteria 66911
111 Ga0265324_10005676 3300029957 Bacteria 5330
112 Ga0265320_10018318 3300031240 Bacteria 3859
113 Ga0265325_10107793 3300031241 Bacteria 1357
114 Ga0265316_10325751 3300031344 Bacteria 1115
115 Ga0265342_10012708 3300031712 Bacteria 5692
116 Ga0307416_100918563 3300032002 Bacteria 976
117 Ga0373934_0018245 3300035086 Bacteria 2683
118 Ga0373923_0038668 3300035111 Bacteria 1956
119 Ga0373936_0207606 3300035113 Bacteria 866
120 Ga0373954_0186991 3300035118 Bacteria 1016
121 Ga0373957_0122722 3300035120 Bacteria 1052
122 Ga0373946_0113561 3300035171 Bacteria 1229
123 Ga0373955_0007407 3300035172 Bacteria 5046
124 Ga0373924_0025105 3300035410 Bacteria 2354
125 Ga0373935_0324239 3300035692 Bacteria 1093
126 Ga0373933_0005209 3300035724 Bacteria 7095
127 Ga0373937_0136280 3300036401 Bacteria 2295
128 Ga0373925_0005498 3300037068 Bacteria 9429
129 Ga0436364_0647844 3300037853 Bacteria 870
130 Ga0436364_0662027 3300037853 Bacteria 799
131 Ga0436364_0798736 3300037853 Bacteria 130922
132 Ga0436364_1478116 3300037853 Unclassified 898
133 Ga0436365_0417080 3300039437 Bacteria 1089
134 Ga0436365_0645926 3300039437 Bacteria 2470
135 Ga0436365_1500188 3300039437 Bacteria 1330
136 Ga0436365_1693874 3300039437 Bacteria 16033
137 Ga0436363_0250279 3300039450 Bacteria 1037
138 Ga0466969_0053218 3300044656 Unclassified 1987
139 Ga0466965_0068906 3300044683 Bacteria 1777
140 Ga0466961_0246660 3300044693 Unclassified 1097
141 Ga0466963_0422572 3300044694 Bacteria 940
142 Ga0466963_0536984 3300044694 Unclassified 826
143 Ga0466968_0020119 3300044735 Bacteria 2691
144 Ga0466968_0021910 3300044735 Unclassified 2592
145 Ga0466968_0042322 3300044735 Bacteria 1926
146 Ga0466957_0279142 3300044842 Bacteria 1118
147 Ga0466967_0282813 3300045976 Bacteria 1592
148 Ga0495592_0010013 3300046454 Bacteria 7139
149 Ga0495651_0212152 3300046462 Bacteria 1346
150 Ga0495651_0575878 3300046462 Bacteria 713
151 Ga0495653_0300758 3300046463 Bacteria 1046
152 Ga0495608_0034116 3300046511 Bacteria 3436
153 Ga0495618_0024912 3300046514 Bacteria 3710
154 Ga0495628_0141314 3300046516 Bacteria 1837
155 Ga0495630_0195911 3300046517 Bacteria 1541
156 Ga0495652_0103566 3300046529 Bacteria 2304
157 Ga0495652_0206619 3300046529 Bacteria 1486
158 Ga0495665_0248291 3300046531 Bacteria 916
159 Ga0495640_0151656 3300046533 Bacteria 1489
160 Ga0495586_0037476 3300046535 Bacteria 2604
161 Ga0495587_0055107 3300046536 Bacteria 2342
162 Ga0495645_0038964 3300046543 Bacteria 3466
163 Ga0495667_0027004 3300046559 Bacteria 3869
164 Ga0495634_0027504 3300046642 Bacteria 3956
165 Ga0495599_0165351 3300046678 Bacteria 1366
166 Ga0495623_0091191 3300046679 Bacteria 1870
167 Ga0495646_0026321 3300046680 Bacteria 3653
168 Ga0495658_0071126 3300046683 Bacteria 2021
169 Ga0495613_0199920 3300046689 Bacteria 1409
170 Ga0495624_0092131 3300046690 Bacteria 1869
171 Ga0495600_0032973 3300046809 Bacteria 3361
172 Ga0495604_0247849 3300047317 Bacteria 1215
173 Ga0495674_0119488 3300047319 Bacteria 2227
174 Ga0495676_0182656 3300047321 Bacteria 1469
175 Ga0495680_0128565 3300047322 Bacteria 1863
176 Ga0495675_0199599 3300047444 Bacteria 1218
177 Ga0495684_0289477 3300047471 Bacteria 1179
178 Ga0495602_0140215 3300048088 Bacteria 1914
179 Ga0496101_0407344 3300048904 Bacteria 1071
180 Ga0496108_0147981 3300048911 Bacteria 2026
181 Ga0496108_0272939 3300048911 Bacteria 1472
182 Ga0496110_0350037 3300048913 Bacteria 1346
183 Ga0501038_0070520 3300049574 Bacteria 2967
184 Ga0501041_0206360 3300049577 Unclassified 1232
185 Ga0501042_0019824 3300049578 Bacteria 4675
186 Ga0501042_0074562 3300049578 Unclassified 2428
187 Ga0501035_0126940 3300049822 Bacteria 2227
188 Ga0501044_0101945 3300049823 Bacteria 2887
189 nmdc:mga09592_4965_c1 3300050508 Bacteria 10778
190 Ga0495601_0085684 3300053077 Bacteria 2024
191 Ga0495612_0063794 3300053078 Bacteria 1528
192 Ga0495619_0221924 3300053085 Bacteria 1309
193 Ga0500566_0005076 3300053094 Bacteria 7847
194 2816426603 2816332119 Bacteria 8120218
195 2837187332 2837183177 Bacteria 4637169
196 Ga0105030_104810
197 JGI24740J21852_10072713
198 JGI24739J22299_10004230
199 JGI24739J22299_10091510
200 JGI24737J22298_10017484
201 Ga0070670_100013672
202 Ga0070670_100268700
203 Ga0068869_100602774
204 Ga0070666_10662394
205 Ga0070682_100173793
206 Ga0068868_100228903
207 Ga0068868_100539948
208 Ga0070668_100095276
209 Ga0070671_100031222
210 Ga0070674_100811017
211 Ga0070673_100047102
212 Ga0070673_100853362
213 Ga0070688_100927569
214 Ga0070667_100025216
215 Ga0070709_10071119
216 Ga0070714_100047626
217 Ga0070714_100072470
218 Ga0070714_100248212
219 Ga0070714_100554570
220 Ga0070714_100562255
221 Ga0070713_100067314
222 Ga0070713_100553169
223 Ga0070710_10161014
224 Ga0070694_100353369
225 Ga0070708_100167715
226 Ga0070663_100254763
227 Ga0068867_100527600
228 Ga0070685_10575240
229 Ga0070706_100528264
230 Ga0070706_100630146
231 Ga0070707_100129341
232 Ga0070707_100770657
233 Ga0070698_100155422
234 Ga0070698_101167170
235 Ga0070697_100518797
236 Ga0070672_100026939
237 Ga0070672_100450236
238 Ga0070672_100617374
239 Ga0070665_100209317
240 Ga0068854_100661290
241 Ga0068856_100237279
242 Ga0070702_100265296
243 Ga0068858_100105873
244 Ga0068860_100239096
245 Ga0068860_101256186
246 Ga0081538_10036778
247 Ga0070717_10031040
248 Ga0075365_10121293
249 Ga0075364_10405091
250 Ga0070716_100026698
251 Ga0070712_100052890
252 Ga0070712_100134012
253 Ga0097621_100116360
254 Ga0075428_100092117
255 Ga0075430_100036197
256 Ga0075431_100028690
257 Ga0075429_100002210
258 Ga0114129_10236690
259 Ga0105248_10003393
260 Ga0105028_102043
261 Ga0105239_10907026
262 Ga0163162_10092446
263 Ga0157372_10302407
264 Ga0157375_10083107
265 Ga0197907_10337270
266 Ga0206355_1015136
267 Ga0213876_10008893
268 Ga0213875_10000941
269 Ga0224712_10004398
270 Ga0224572_1010628
271 Ga0207692_10020700
272 Ga0207647_10022176
273 Ga0207699_10249133
274 Ga0207645_10620899
275 Ga0207643_10496907
276 Ga0207684_10502405
277 Ga0207693_10005447
278 Ga0207693_10071584
279 Ga0207646_10026413
280 Ga0207650_10895991
281 Ga0207700_10089704
282 Ga0207700_10145102
283 Ga0207664_10207224
284 Ga0207664_10473088
285 Ga0207644_10029544
286 Ga0207706_10055625
287 Ga0207670_10369709
288 Ga0207665_10052443
289 Ga0207691_10009400
290 Ga0207691_10493983
291 Ga0207711_10030040
292 Ga0207689_10580558
293 Ga0207668_10077091
294 Ga0207658_10151505
295 Ga0207677_10471798
296 Ga0207674_10636492
297 Ga0207698_10904254
298 Ga0268264_10909648
299 Ga0265337_1001241
300 Ga0265326_10008076
301 Ga0265334_10007525
302 Ga0265318_10034277
303 Ga0265323_10023204
304 Ga0265336_10011935
305 Ga0265338_10000530
306 Ga0265324_10005676
307 Ga0265320_10018318
308 Ga0265325_10107793
309 Ga0265316_10325751
310 Ga0265342_10012708
311 Ga0307416_100918563
312 Ga0373934_0018245
313 Ga0373923_0038668
314 Ga0373936_0207606
315 Ga0373954_0186991
316 Ga0373957_0122722
317 Ga0373946_0113561
318 Ga0373955_0007407
319 Ga0373924_0025105
320 Ga0373935_0324239
321 Ga0373933_0005209
322 Ga0373937_0136280
323 Ga0373925_0005498
324 Ga0436364_0647844
325 Ga0436364_0662027
326 Ga0436364_0798736
327 Ga0436364_1478116
328 Ga0436365_0417080
329 Ga0436365_0645926
330 Ga0436365_1500188
331 Ga0436365_1693874
332 Ga0436363_0250279
333 Ga0466969_0053218
334 Ga0466965_0068906
335 Ga0466961_0246660
336 Ga0466963_0422572
337 Ga0466963_0536984
338 Ga0466968_0020119
339 Ga0466968_0021910
340 Ga0466968_0042322
341 Ga0466957_0279142
342 Ga0466967_0282813
343 Ga0495592_0010013
344 Ga0495651_0212152
345 Ga0495651_0575878
346 Ga0495653_0300758
347 Ga0495608_0034116
348 Ga0495618_0024912
349 Ga0495628_0141314
350 Ga0495630_0195911
351 Ga0495652_0103566
352 Ga0495652_0206619
353 Ga0495665_0248291
354 Ga0495640_0151656
355 Ga0495586_0037476
356 Ga0495587_0055107
357 Ga0495645_0038964
358 Ga0495667_0027004
359 Ga0495634_0027504
360 Ga0495599_0165351
361 Ga0495623_0091191
362 Ga0495646_0026321
363 Ga0495658_0071126
364 Ga0495613_0199920
365 Ga0495624_0092131
366 Ga0495600_0032973
367 Ga0495604_0247849
368 Ga0495674_0119488
369 Ga0495676_0182656
370 Ga0495680_0128565
371 Ga0495675_0199599
372 Ga0495684_0289477
373 Ga0495602_0140215
374 Ga0496101_0407344
375 Ga0496108_0147981
376 Ga0496108_0272939
377 Ga0496110_0350037
378 Ga0501038_0070520
379 Ga0501041_0206360
380 Ga0501042_0019824
381 Ga0501042_0074562
382 Ga0501035_0126940
383 Ga0501044_0101945
384 nmdc:mga09592_4965_c1
385 Ga0495601_0085684
386 Ga0495612_0063794
387 Ga0495619_0221924
388 Ga0500566_0005076
389 2816426603
390 2837187332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

44

222

0.82

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

41

222

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.7836 5 202
4knw-assembly1.cif.gz_A the crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate 0.7799 6 203
2b0c-assembly1.cif.gz_A-2 the crystal structure of the putative phosphatase from escherichia coli 0.778 6 200
4dfd-assembly2.cif.gz_B crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex 0.778 4 199
4f72-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate 0.7743 6 189
ID Description Score Start End Superfamily
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9165 90 189 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9155 91 202 3.40.50.1000
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9122 165 189 3.40.50.150
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9029 90 187 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8994 6 185 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1I2PY30-F1-model_v4 2-haloacid dehalogenase 0.991 11 205
AF-A0A2W2AJU6-F1-model_v4 HAD family phosphatase 0.9902 9 202
AF-A0A395CWX2-F1-model_v4 2-haloalkanoic acid dehalogenase 0.9897 6 200
AF-A0A5A7N726-F1-model_v4 Haloacid dehalogenase 0.9887 5 205
AF-A0A2D2D4R8-F1-model_v4 HAD family phosphatase 0.9875 4 201

Map