F299890

General Info

Members Datasets Scaffolds Average Seq Length
195 118 390 284

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10013605|Ga0075365_100136055
Length 300
Sequence MTTTRVPRPTGTVTTESGLVVVDKPAGLTSHDVVARVRRLAGTRKVGHAGTLDPMATGVLVVGVERATRLLGHLMLTEKAYDATVRLGVATTTDDAEGEVVSTTPAGGLTEAGVRAVLGEFVGDLLQVPTAVSAIKVDGKRAYQRVRDGEQVELEPRPVTVHELLVHDVRHTGDAVDVDVSLRCSSGTYVRAIARDAGARLGVGGHLTALRRTAVGPYRLDAAHTLDQLAEELTILPIRDAARAAFASVDLDDTAAADVRVGRPLDLPVGGLSALFAPDGEFLALYEPRDGRARPVAVFV

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
33 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
42 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
54 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
55 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
56 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
57 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
58 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
59 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
60 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
61 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
62 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
63 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
98 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
99 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
103 2643221561 Nocardioides sp. Root151 Isolate Unclassified
104 2643221576 Nocardioides sp. Root614 Isolate Unclassified
105 2643221590 Nocardioides sp. Root682 Isolate Unclassified
106 2643221604 Nocardioides sp. Root190 Isolate Unclassified
107 2643221615 Nocardioides sp. Root224 Isolate Unclassified
108 2643221617 Nocardioides sp. Root79 Isolate Unclassified
109 2643221620 Nocardioides sp. Root240 Isolate Unclassified
110 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
111 2643221696 Nocardioides sp. Root140 Isolate Unclassified
112 2738541305 Nocardioides sp. CF167 Isolate Unclassified
113 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
114 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
115 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
116 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
117 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
118 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.79
Metatranscriptomes 0
Isolates 8.21

Biome Distribution

Category Percentage (%)
Aerial Root 1.03
Bulb 0
Endosphere 22.56
Nodule 0.51
Rhizoplane 7.18
Rhizosphere 62.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10013605 3300006038 Bacteria 4875
2 Ga0070660_100037467 3300005339 Bacteria 3676
3 Ga0070671_100456905 3300005355 Bacteria 1096
4 Ga0070659_100032255 3300005366 Bacteria 4062
5 Ga0070659_100076030 3300005366 Bacteria 2678
6 Ga0070667_100027045 3300005367 Bacteria 4772
7 Ga0070707_100033351 3300005468 Bacteria 4910
8 Ga0070698_100038510 3300005471 Bacteria 4926
9 Ga0070698_100604603 3300005471 Bacteria 1037
10 Ga0068861_100174211 3300005719 Bacteria 1785
11 Ga0068860_100000451 3300005843 Bacteria 51981
12 Ga0075365_10011192 3300006038 Bacteria 5266
13 Ga0075365_10022132 3300006038 Bacteria 3978
14 Ga0075365_10031271 3300006038 Bacteria 3414
15 Ga0075365_10070181 3300006038 Bacteria 2356
16 Ga0075365_10144352 3300006038 Bacteria 1653
17 Ga0075365_10369529 3300006038 Bacteria 1011
18 Ga0075368_10026066 3300006042 Bacteria 2247
19 Ga0075363_100000837 3300006048 Bacteria 10697
20 Ga0075363_100024427 3300006048 Bacteria 3072
21 Ga0075363_100058740 3300006048 Bacteria 2066
22 Ga0075363_100058914 3300006048 Bacteria 2063
23 Ga0075363_100182709 3300006048 Bacteria 1194
24 Ga0075364_10065963 3300006051 Bacteria 2377
25 Ga0075364_10085948 3300006051 Bacteria 2083
26 Ga0075364_10104830 3300006051 Bacteria 1884
27 Ga0075364_10139604 3300006051 Bacteria 1629
28 Ga0075367_10017438 3300006178 Bacteria 3942
29 Ga0075367_10047895 3300006178 Bacteria 2516
30 Ga0075367_10060551 3300006178 Bacteria 2257
31 Ga0075370_10129424 3300006353 Bacteria 1472
32 Ga0111539_10424017 3300009094 Bacteria 1549
33 Ga0105243_10101698 3300009148 Bacteria 2387
34 Ga0105243_10299536 3300009148 Bacteria 1457
35 Ga0105242_10171540 3300009176 Bacteria 1907
36 Ga0105249_10259187 3300009553 Bacteria 1727
37 Ga0157375_10020470 3300013308 Bacteria 6045
38 Ga0157376_10233726 3300014969 Bacteria 1709
39 Ga0163161_10144864 3300017792 Bacteria 1801
40 Ga0207647_10023633 3300025904 Bacteria 4063
41 Ga0207647_10115710 3300025904 Bacteria 1583
42 Ga0207705_10072202 3300025909 Bacteria 2503
43 Ga0207671_10367070 3300025914 Bacteria 1143
44 Ga0207657_10021098 3300025919 Bacteria 6138
45 Ga0207690_10101477 3300025932 Bacteria 2056
46 Ga0207709_10206619 3300025935 Bacteria 1406
47 Ga0207712_10290304 3300025961 Bacteria 1338
48 Ga0207668_10228099 3300025972 Bacteria 1500
49 Ga0207658_10070225 3300025986 Bacteria 2649
50 Ga0207708_10045552 3300026075 Bacteria 3343
51 Ga0209813_10002371 3300027866 Bacteria 4320
52 Ga0268264_10000305 3300028381 Bacteria 78992
53 Ga0307408_100221650 3300031548 Bacteria 1544
54 Ga0307413_10113885 3300031824 Bacteria 1817
55 Ga0307410_10211251 3300031852 Bacteria 1487
56 Ga0307415_100064679 3300032126 Bacteria 2546
57 Ga0395900_0062090 3300037418 Bacteria 3841
58 Ga0395898_0191314 3300037466 Bacteria 1955
59 Ga0395901_0271910 3300038443 Bacteria 1762
60 Ga0439431_0002769 3300041997 Bacteria 3858
61 Ga0439446_0028364 3300042156 Bacteria 1611
62 Ga0466965_0001848 3300044683 Bacteria 8799
63 Ga0466965_0007409 3300044683 Bacteria 5036
64 Ga0466965_0024452 3300044683 Bacteria 2922
65 Ga0466961_0062756 3300044693 Bacteria 2361
66 Ga0466964_0000629 3300044706 Bacteria 11238
67 Ga0466964_0041734 3300044706 Bacteria 1857
68 Ga0466971_0030025 3300044719 Bacteria 2432
69 Ga0466971_0086407 3300044719 Bacteria 1434
70 Ga0466968_0036090 3300044735 Bacteria 2070
71 Ga0466968_0037342 3300044735 Bacteria 2038
72 Ga0466970_0006738 3300044765 Bacteria 5749
73 Ga0466970_0104233 3300044765 Bacteria 1546
74 Ga0466957_0077325 3300044842 Bacteria 2067
75 Ga0466957_0195461 3300044842 Bacteria 1327
76 Ga0466960_0003787 3300044901 Bacteria 5857
77 Ga0466960_0071264 3300044901 Bacteria 1730
78 Ga0466959_0169799 3300045049 Bacteria 1530
79 Ga0466967_0026920 3300045976 Bacteria 4773
80 Ga0466967_0033541 3300045976 Bacteria 4347
81 Ga0466967_0078590 3300045976 Bacteria 2972
82 Ga0466967_0266653 3300045976 Bacteria 1639
83 Ga0466967_0622445 3300045976 Bacteria 1066
84 Ga0495653_0176089 3300046463 Bacteria 1472
85 Ga0495582_0120254 3300046473 Bacteria 1480
86 Ga0495658_0061374 3300046683 Bacteria 2158
87 Ga0496100_0060206 3300048903 Bacteria 2498
88 Ga0496101_0320457 3300048904 Bacteria 1216
89 Ga0496102_0119534 3300048905 Bacteria 2460
90 Ga0496104_0006861 3300048907 Bacteria 10037
91 Ga0496105_0004845 3300048908 Bacteria 10163
92 Ga0496106_0099830 3300048909 Bacteria 2250
93 Ga0496107_0101616 3300048910 Bacteria 2108
94 Ga0496109_0031276 3300048912 Bacteria 4775
95 Ga0496109_0165270 3300048912 Bacteria 2074
96 Ga0496110_0316309 3300048913 Bacteria 1422
97 Ga0496114_0016635 3300048917 Bacteria 5930
98 Ga0496114_0104365 3300048917 Bacteria 2423
99 Ga0496114_0164240 3300048917 Bacteria 1932
100 Ga0496114_0376765 3300048917 Bacteria 1256
101 Ga0501032_0005625 3300049569 Bacteria 9285
102 Ga0501032_0125411 3300049569 Bacteria 1696
103 Ga0501033_0029018 3300049570 Bacteria 4156
104 Ga0501033_0167490 3300049570 Bacteria 1579
105 Ga0501034_0009813 3300049571 Bacteria 10009
106 Ga0501034_0151162 3300049571 Bacteria 2297
107 Ga0501034_0362611 3300049571 Bacteria 1376
108 Ga0501034_0478870 3300049571 Bacteria 1160
109 Ga0501036_0008172 3300049572 Bacteria 8577
110 Ga0501036_0019560 3300049572 Bacteria 5685
111 Ga0501037_0017187 3300049573 Bacteria 5325
112 Ga0501037_0064838 3300049573 Bacteria 2661
113 Ga0501038_0011330 3300049574 Bacteria 8141
114 Ga0501039_0033639 3300049575 Bacteria 3953
115 Ga0501040_0155116 3300049576 Bacteria 1617
116 Ga0501042_0059670 3300049578 Bacteria 2724
117 Ga0501043_0007834 3300049579 Bacteria 8444
118 Ga0501046_0008086 3300049580 Bacteria 9192
119 Ga0501046_0063290 3300049580 Bacteria 2889
120 Ga0501047_0009384 3300049581 Bacteria 9243
121 Ga0501047_0121923 3300049581 Bacteria 2488
122 Ga0501047_0302599 3300049581 Bacteria 1441
123 Ga0501048_0001905 3300049582 Bacteria 15841
124 Ga0501067_0001852 3300049583 Bacteria 11638
125 Ga0501067_0016032 3300049583 Bacteria 4144
126 Ga0501068_0004395 3300049584 Bacteria 7670
127 Ga0501069_0069450 3300049585 Bacteria 1972
128 Ga0501069_0078599 3300049585 Bacteria 1856
129 Ga0501069_0137422 3300049585 Bacteria 1401
130 Ga0501070_0001372 3300049586 Bacteria 21777
131 Ga0501070_0035985 3300049586 Bacteria 4134
132 Ga0501070_0081502 3300049586 Bacteria 2677
133 Ga0501071_0006585 3300049587 Bacteria 7545
134 Ga0501071_0179805 3300049587 Bacteria 1585
135 Ga0501073_0063573 3300049589 Bacteria 2574
136 Ga0501073_0215874 3300049589 Bacteria 1325
137 Ga0501074_0014548 3300049590 Bacteria 5725
138 Ga0501074_0075394 3300049590 Bacteria 2421
139 Ga0501074_0152852 3300049590 Bacteria 1649
140 Ga0501074_0243779 3300049590 Bacteria 1278
141 Ga0501077_0173183 3300049593 Bacteria 1371
142 Ga0501080_0028783 3300049742 Bacteria 5172
143 Ga0501080_0092659 3300049742 Bacteria 2806
144 Ga0501080_0243339 3300049742 Bacteria 1641
145 Ga0501083_0164098 3300049744 Bacteria 1452
146 Ga0501035_0330286 3300049822 Bacteria 1279
147 Ga0501035_0330298 3300049822 Bacteria 1279
148 Ga0501044_0016962 3300049823 Bacteria 7814
149 Ga0501044_0017336 3300049823 Bacteria 7724
150 Ga0501044_0151736 3300049823 Bacteria 2299
151 Ga0501044_0272284 3300049823 Bacteria 1628
152 Ga0501044_0450466 3300049823 Bacteria 1194
153 nmdc:mga03n38_155766_c1 3300050490 Bacteria 1153
154 nmdc:mga03n38_2934_c1 3300050490 Bacteria 5379
155 nmdc:mga03n38_6222_c1 3300050490 Bacteria 4129
156 nmdc:mga00v17_178637_c1 3300050491 Bacteria 1369
157 nmdc:mga00v17_65769_c1 3300050491 Bacteria 2238
158 nmdc:mga0yw44_115533_c1 3300050492 Bacteria 1724
159 nmdc:mga0yw44_12530_c1 3300050492 Bacteria 4425
160 nmdc:mga0yw44_125988_c1 3300050492 Bacteria 1654
161 nmdc:mga0yw44_14528_c1 3300050492 Bacteria 4185
162 nmdc:mga0yw44_23475_c1 3300050492 Bacteria 3475
163 nmdc:mga0yw44_6297_c1 3300050492 Bacteria 3912
164 nmdc:mga0yw44_81576_c1 3300050492 Bacteria 2028
165 nmdc:mga0yw44_8253_c1 3300050492 Bacteria 5175
166 nmdc:mga0yw44_82666_c1 3300050492 Bacteria 2015
167 nmdc:mga06z11_33149_c1 3300050494 Bacteria 2025
168 nmdc:mga04h51_1785_c1 3300050495 Bacteria 5034
169 nmdc:mga04h51_58923_c1 3300050495 Bacteria 1311
170 nmdc:mga04h51_75623_c1 3300050495 Bacteria 1185
171 nmdc:mga07m45_14561_c2 3300050496 Bacteria 2836
172 Ga0500556_0000964 3300053104 Bacteria 15406
173 Ga0500593_000417 3300053117 Bacteria 16810
174 Ga0500573_0020467 3300053140 Bacteria 3790
175 Ga0501084_0058033 3300054114 Bacteria 3238
176 Ga0501084_0245768 3300054114 Bacteria 1510
177 Ga0501082_0083051 3300060353 Bacteria 2764
178 Ga0501082_0085095 3300060353 Bacteria 2727
179 Ga0530510_0191723 3300061734 Bacteria 1517
180 2643825439 2643221561 Bacteria 4984412
181 2643889101 2643221576 Bacteria 5214352
182 2643958156 2643221590 Bacteria 5214697
183 2644034637 2643221604 Bacteria 5014917
184 2644089746 2643221615 Bacteria 5487866
185 2644099010 2643221617 Bacteria 5139111
186 2644114891 2643221620 Bacteria 5134593
187 2644319591 2643221657 Bacteria 5490246
188 2644531436 2643221696 Bacteria 5431823
189 2738867948 2738541305 Bacteria 4910150
190 2774393509 2773857762 Bacteria 5971770
191 2812332264 2811994874 Bacteria 5367947
192 2857485997 2857481737 Bacteria 4761446
193 2984577017 2984576629 Bacteria 4248407
194 2990258764 2990256926 Bacteria 4252839
195 8054612593 8054609563 Bacteria 5170090
196 Ga0075365_10013605
197 Ga0070660_100037467
198 Ga0070671_100456905
199 Ga0070659_100032255
200 Ga0070659_100076030
201 Ga0070667_100027045
202 Ga0070707_100033351
203 Ga0070698_100038510
204 Ga0070698_100604603
205 Ga0068861_100174211
206 Ga0068860_100000451
207 Ga0075365_10011192
208 Ga0075365_10022132
209 Ga0075365_10031271
210 Ga0075365_10070181
211 Ga0075365_10144352
212 Ga0075365_10369529
213 Ga0075368_10026066
214 Ga0075363_100000837
215 Ga0075363_100024427
216 Ga0075363_100058740
217 Ga0075363_100058914
218 Ga0075363_100182709
219 Ga0075364_10065963
220 Ga0075364_10085948
221 Ga0075364_10104830
222 Ga0075364_10139604
223 Ga0075367_10017438
224 Ga0075367_10047895
225 Ga0075367_10060551
226 Ga0075370_10129424
227 Ga0111539_10424017
228 Ga0105243_10101698
229 Ga0105243_10299536
230 Ga0105242_10171540
231 Ga0105249_10259187
232 Ga0157375_10020470
233 Ga0157376_10233726
234 Ga0163161_10144864
235 Ga0207647_10023633
236 Ga0207647_10115710
237 Ga0207705_10072202
238 Ga0207671_10367070
239 Ga0207657_10021098
240 Ga0207690_10101477
241 Ga0207709_10206619
242 Ga0207712_10290304
243 Ga0207668_10228099
244 Ga0207658_10070225
245 Ga0207708_10045552
246 Ga0209813_10002371
247 Ga0268264_10000305
248 Ga0307408_100221650
249 Ga0307413_10113885
250 Ga0307410_10211251
251 Ga0307415_100064679
252 Ga0395900_0062090
253 Ga0395898_0191314
254 Ga0395901_0271910
255 Ga0439431_0002769
256 Ga0439446_0028364
257 Ga0466965_0001848
258 Ga0466965_0007409
259 Ga0466965_0024452
260 Ga0466961_0062756
261 Ga0466964_0000629
262 Ga0466964_0041734
263 Ga0466971_0030025
264 Ga0466971_0086407
265 Ga0466968_0036090
266 Ga0466968_0037342
267 Ga0466970_0006738
268 Ga0466970_0104233
269 Ga0466957_0077325
270 Ga0466957_0195461
271 Ga0466960_0003787
272 Ga0466960_0071264
273 Ga0466959_0169799
274 Ga0466967_0026920
275 Ga0466967_0033541
276 Ga0466967_0078590
277 Ga0466967_0266653
278 Ga0466967_0622445
279 Ga0495653_0176089
280 Ga0495582_0120254
281 Ga0495658_0061374
282 Ga0496100_0060206
283 Ga0496101_0320457
284 Ga0496102_0119534
285 Ga0496104_0006861
286 Ga0496105_0004845
287 Ga0496106_0099830
288 Ga0496107_0101616
289 Ga0496109_0031276
290 Ga0496109_0165270
291 Ga0496110_0316309
292 Ga0496114_0016635
293 Ga0496114_0104365
294 Ga0496114_0164240
295 Ga0496114_0376765
296 Ga0501032_0005625
297 Ga0501032_0125411
298 Ga0501033_0029018
299 Ga0501033_0167490
300 Ga0501034_0009813
301 Ga0501034_0151162
302 Ga0501034_0362611
303 Ga0501034_0478870
304 Ga0501036_0008172
305 Ga0501036_0019560
306 Ga0501037_0017187
307 Ga0501037_0064838
308 Ga0501038_0011330
309 Ga0501039_0033639
310 Ga0501040_0155116
311 Ga0501042_0059670
312 Ga0501043_0007834
313 Ga0501046_0008086
314 Ga0501046_0063290
315 Ga0501047_0009384
316 Ga0501047_0121923
317 Ga0501047_0302599
318 Ga0501048_0001905
319 Ga0501067_0001852
320 Ga0501067_0016032
321 Ga0501068_0004395
322 Ga0501069_0069450
323 Ga0501069_0078599
324 Ga0501069_0137422
325 Ga0501070_0001372
326 Ga0501070_0035985
327 Ga0501070_0081502
328 Ga0501071_0006585
329 Ga0501071_0179805
330 Ga0501073_0063573
331 Ga0501073_0215874
332 Ga0501074_0014548
333 Ga0501074_0075394
334 Ga0501074_0152852
335 Ga0501074_0243779
336 Ga0501077_0173183
337 Ga0501080_0028783
338 Ga0501080_0092659
339 Ga0501080_0243339
340 Ga0501083_0164098
341 Ga0501035_0330286
342 Ga0501035_0330298
343 Ga0501044_0016962
344 Ga0501044_0017336
345 Ga0501044_0151736
346 Ga0501044_0272284
347 Ga0501044_0450466
348 nmdc:mga03n38_155766_c1
349 nmdc:mga03n38_2934_c1
350 nmdc:mga03n38_6222_c1
351 nmdc:mga00v17_178637_c1
352 nmdc:mga00v17_65769_c1
353 nmdc:mga0yw44_115533_c1
354 nmdc:mga0yw44_12530_c1
355 nmdc:mga0yw44_125988_c1
356 nmdc:mga0yw44_14528_c1
357 nmdc:mga0yw44_23475_c1
358 nmdc:mga0yw44_6297_c1
359 nmdc:mga0yw44_81576_c1
360 nmdc:mga0yw44_8253_c1
361 nmdc:mga0yw44_82666_c1
362 nmdc:mga06z11_33149_c1
363 nmdc:mga04h51_1785_c1
364 nmdc:mga04h51_58923_c1
365 nmdc:mga04h51_75623_c1
366 nmdc:mga07m45_14561_c2
367 Ga0500556_0000964
368 Ga0500593_000417
369 Ga0500573_0020467
370 Ga0501084_0058033
371 Ga0501084_0245768
372 Ga0501082_0083051
373 Ga0501082_0085095
374 Ga0530510_0191723
375 2643825439
376 2643889101
377 2643958156
378 2644034637
379 2644089746
380 2644099010
381 2644114891
382 2644319591
383 2644531436
384 2738867948
385 2774393509
386 2812332264
387 2857485997
388 2984577017
389 2990258764
390 8054612593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01509

TruB_N

TruB family pseudouridylate synthase (N terminal domain)

38

190

0.98

PF09142

TruB_C

tRNA Pseudouridine synthase II, C terminal

246

300

0.98

PF16198

TruB_C_2

tRNA pseudouridylate synthase B C-terminal domain

191

244

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sgv-assembly1.cif.gz_A structure of trna psi55 pseudouridine synthase (trub) 0.8717 10 267
1ze2-assembly1.cif.gz_A conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.8612 10 267
1sgv-assembly1.cif.gz_A structure of trna psi55 pseudouridine synthase (trub) 0.8558 10 267
1ze1-assembly4.cif.gz_D conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.8506 10 255
1r3f-assembly1.cif.gz_A crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit 0.845 11 268
ID Description Score Start End Superfamily
af_B9F4Z0_25_81_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9691 11 62 3.30.2350.10
1s71A02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.94 204 266 2.30.130.10
1s71A02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9122 204 266 2.30.130.10
1r3fA01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8786 11 197 3.30.2350.10
af_B9F4Z0_25_81_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8722 11 62 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A7K2IP94-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.911 9 267 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A1X1TUJ9-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.903 11 267 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A1E3R793-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9009 10 267 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A375YKB2-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9003 6 267 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A7X6HGQ5-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.8992 1 268 GO:0003723
GO:0009982
GO:0031119
GO:0140098
GO:1990481

Map