F299584

General Info

Members Datasets Scaffolds Average Seq Length
195 161 374 324

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100014355|Ga0070683_1000143552
Length 348
Sequence LAPVSLVRVGRGEGMKPLVLTSMSGFHFTVSSYAEVTIPFAFRFVWGQLPSPDKLAAYLGPGSGEHGSGSQWSDYVDWTMRGGKTRTKLALIDFCRNYDVVEFWFDPSPNDQLLLVWLLDYFHSDPDIATKLTVRLLDCSLHEIDHKRSDPYEVLEAEVTGAEFETAGMVWHAYREPTPEACFGLLRKDLGALPLLKPALRNLLEELPSASTGLGATEMRMLELIARGYEHVNTLFHIHELRRTCIFNEWEHGYLLERLAHGPTPAVAGLDDELRTISQEKLGARHPLFLRSRLSPTEFGEAVVAHEADFSRHNPIDRWWGGTHLTNDRLWRYDPVLTRSWARGDEAP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
35 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
66 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
67 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
112 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
113 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
114 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
115 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
116 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
123 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
124 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
125 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
126 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
127 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
128 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
129 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
130 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
131 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
132 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
133 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
134 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
135 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
136 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
137 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
138 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
139 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
140 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
141 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
142 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
143 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
144 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
145 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
146 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
147 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
148 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
149 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
150 2922425934
151 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
152 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
153 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
154 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
155 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
156 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
157 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
158 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
159 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
160 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
161 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.41
Metatranscriptomes 0
Isolates 19.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.95
Nodule 18.97
Rhizoplane 2.05
Rhizosphere 51.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100014355 3300005329 Bacteria 6928
2 JGI25153J46596_10008457 3300003215 Bacteria 4917
3 rootH2_10071826 3300003320 Bacteria 2200
4 rootH1_10040889 3300003323 Bacteria 2928
5 rootH1_10157021 3300003323 Bacteria 1738
6 Ga0055529_1004138 3300003763 Bacteria 2248
7 Ga0055543_1002758 3300004625 Bacteria 5577
8 Ga0065165_1000626 3300005262 Bacteria 51320
9 Ga0070683_100405760 3300005329 Bacteria 1300
10 Ga0068869_100091830 3300005334 Bacteria 2284
11 Ga0070680_100030827 3300005336 Bacteria 4308
12 Ga0070680_100327546 3300005336 Bacteria 1301
13 Ga0070680_100378725 3300005336 Bacteria 1205
14 Ga0070682_100021272 3300005337 Bacteria 3825
15 Ga0070660_100361619 3300005339 Bacteria 1196
16 Ga0070691_10136647 3300005341 Bacteria 1246
17 Ga0070668_100387624 3300005347 Bacteria 1190
18 Ga0070667_100185995 3300005367 Bacteria 1838
19 Ga0070711_100025838 3300005439 Bacteria 3844
20 Ga0070663_100105342 3300005455 Bacteria 2111
21 Ga0070681_10113375 3300005458 Bacteria 2650
22 Ga0070679_100064905 3300005530 Bacteria 3639
23 Ga0070679_100278829 3300005530 Bacteria 1624
24 Ga0070684_100149098 3300005535 Bacteria 2118
25 Ga0068853_100310520 3300005539 Bacteria 1460
26 Ga0070665_100136129 3300005548 Bacteria 2459
27 Ga0068855_100232267 3300005563 Bacteria 2065
28 Ga0068855_100380292 3300005563 Bacteria 1550
29 Ga0068852_100014961 3300005616 Bacteria 5997
30 Ga0068852_100268614 3300005616 Bacteria 1640
31 Ga0068866_10146497 3300005718 Bacteria 1362
32 Ga0068862_100051923 3300005844 Bacteria 3507
33 Ga0081455_10058868 3300005937 Bacteria 3248
34 Ga0081455_10089850 3300005937 Bacteria 2492
35 Ga0081540_1008486 3300005983 Bacteria 7172
36 Ga0081540_1032397 3300005983 Bacteria 2855
37 Ga0075365_10060540 3300006038 Bacteria 2526
38 Ga0070712_100019058 3300006175 Bacteria 4466
39 Ga0075362_10041465 3300006177 Bacteria 2031
40 Ga0075369_10055461 3300006186 Bacteria 1722
41 Ga0075366_10148510 3300006195 Bacteria 1419
42 Ga0075370_10130442 3300006353 Bacteria 1466
43 Ga0099824_1002235 3300006942 Bacteria 28253
44 Ga0099822_1030154 3300006943 Bacteria 4127
45 Ga0105240_10007615 3300009093 Bacteria 15682
46 Ga0105240_10194453 3300009093 Bacteria 2383
47 Ga0105240_10205432 3300009093 Bacteria 2306
48 Ga0111539_10765810 3300009094 Bacteria 1123
49 Ga0105245_10057003 3300009098 Bacteria 3513
50 Ga0105247_10083193 3300009101 Bacteria 2021
51 Ga0105241_10054514 3300009174 Bacteria 3060
52 Ga0105237_10013252 3300009545 Bacteria 8649
53 Ga0105237_10113717 3300009545 Bacteria 2699
54 Ga0105237_10631465 3300009545 Bacteria 1078
55 Ga0105239_10066156 3300010375 Bacteria 3971
56 Ga0105239_10431155 3300010375 Bacteria 1494
57 Ga0157370_10135838 3300013104 Bacteria 2292
58 Ga0163162_10298318 3300013306 Bacteria 1743
59 Ga0157372_10138396 3300013307 Bacteria 2805
60 Ga0157375_10700236 3300013308 Bacteria 1167
61 Ga0157379_10233096 3300014968 Bacteria 1669
62 Ga0209563_102451 3300025230 Bacteria 4193
63 Ga0209677_101763 3300025253 Bacteria 8965
64 Ga0209148_1000673 3300025254 Bacteria 28884
65 Ga0209455_1006912 3300025272 Bacteria 3288
66 Ga0209758_1006089 3300025297 Bacteria 8869
67 Ga0209758_1011397 3300025297 Bacteria 5155
68 Ga0207654_10030792 3300025911 Bacteria 2949
69 Ga0207707_10020568 3300025912 Bacteria 5764
70 Ga0207707_10193827 3300025912 Bacteria 1772
71 Ga0207695_10000029 3300025913 Bacteria 548364
72 Ga0207671_10019398 3300025914 Bacteria 5199
73 Ga0207693_10047654 3300025915 Bacteria 3367
74 Ga0207652_10092304 3300025921 Bacteria 2663
75 Ga0207689_10200786 3300025942 Bacteria 1646
76 Ga0207661_10003384 3300025944 Bacteria 11079
77 Ga0207661_10039162 3300025944 Bacteria 3719
78 Ga0207667_10030740 3300025949 Bacteria 5804
79 Ga0207667_10271861 3300025949 Bacteria 1732
80 Ga0207668_10206050 3300025972 Bacteria 1569
81 Ga0207675_100185866 3300026118 Bacteria 1992
82 Ga0207698_10010793 3300026142 Bacteria 5892
83 Ga0209589_1000018 3300027357 Bacteria 192614
84 Ga0209489_100017 3300027361 Bacteria 223265
85 Ga0209489_100026 3300027361 Bacteria 192614
86 Ga0209700_100035 3300027363 Bacteria 192614
87 Ga0268266_10086415 3300028379 Bacteria 2742
88 Ga0268265_10149568 3300028380 Bacteria 1967
89 Ga0307509_10329326 3300031507 Bacteria 1260
90 Ga0265314_10023049 3300031711 Bacteria 4756
91 Ga0307413_10020967 3300031824 Bacteria 3488
92 Ga0307411_10188326 3300032005 Bacteria 1573
93 Ga0315911_1000011 3300033442 Bacteria 264678
94 Ga0373927_0015680 3300035695 Bacteria 5005
95 Ga0373925_0057230 3300037068 Bacteria 2921
96 Ga0395899_0282276 3300037312 Bacteria 1129
97 Ga0395900_0004267 3300037418 Bacteria 15158
98 Ga0395898_0077186 3300037466 Bacteria 3216
99 Ga0395905_0128946 3300037471 Bacteria 2379
100 Ga0436364_0459666 3300037853 Bacteria 1645
101 Ga0395901_0102269 3300038443 Bacteria 3007
102 Ga0395901_0228434 3300038443 Bacteria 1944
103 Ga0436365_0750436 3300039437 Bacteria 2762
104 Ga0436360_0876613 3300039438 Bacteria 995
105 Ga0466972_0012548 3300044658 Bacteria 4257
106 Ga0466967_0047799 3300045976 Bacteria 3732
107 Ga0495638_0092840 3300046460 Bacteria 1816
108 Ga0495605_0043659 3300046474 Bacteria 2221
109 Ga0495585_0166511 3300046492 Bacteria 1141
110 Ga0495594_0130698 3300046499 Bacteria 1422
111 Ga0495596_0066766 3300046500 Bacteria 1398
112 Ga0495606_0039703 3300046507 Bacteria 3168
113 Ga0495610_0088541 3300046512 Bacteria 1407
114 Ga0495643_0062212 3300046522 Bacteria 1977
115 Ga0495648_0036423 3300046524 Bacteria 3175
116 Ga0495648_0143335 3300046524 Bacteria 1254
117 Ga0495652_0054610 3300046529 Bacteria 3401
118 Ga0495588_0051764 3300046674 Bacteria 2115
119 Ga0495671_0083559 3300046692 Bacteria 1565
120 Ga0495649_0052697 3300046694 Bacteria 2204
121 Ga0495604_0030189 3300047317 Bacteria 4308
122 Ga0495676_0125673 3300047321 Bacteria 1859
123 Ga0495683_0060600 3300047323 Bacteria 1875
124 Ga0496100_0135081 3300048903 Bacteria 1742
125 Ga0496102_0188912 3300048905 Bacteria 1941
126 Ga0496107_0291007 3300048910 Bacteria 1216
127 Ga0496115_0110259 3300048918 Bacteria 2261
128 Ga0496121_0050658 3300048924 Bacteria 3505
129 Ga0496121_0084181 3300048924 Bacteria 2508
130 Ga0496126_0174891 3300048929 Bacteria 1827
131 Ga0496126_0211982 3300048929 Bacteria 1630
132 Ga0495682_0015827 3300049460 Bacteria 2856
133 nmdc:mga0k408_116003_c1 3300050493 Bacteria 1584
134 nmdc:mga0sz30_156310_c1 3300050516 Bacteria 1010
135 Ga0500578_0136967 3300053086 Bacteria 1532
136 Ga0500583_0139565 3300053092 Bacteria 1204
137 Ga0500641_0114690 3300053096 Bacteria 1160
138 Ga0500556_0059408 3300053104 Bacteria 1404
139 Ga0500595_011282 3300053119 Bacteria 3505
140 Ga0500658_0072614 3300053134 Bacteria 1455
141 Ga0500559_0048940 3300053136 Bacteria 1861
142 Ga0500577_0025502 3300053142 Bacteria 2002
143 Ga0500588_0079535 3300053146 Bacteria 1094
144 Ga0500616_0059140 3300053153 Bacteria 1991
145 Ga0500638_004793 3300053162 Bacteria 5286
146 Ga0500637_0000520 3300053178 Bacteria 15017
147 Ga0500599_000807 3300053736 Bacteria 3458
148 Ga0500661_002784 3300055283 Bacteria 3299
149 2513858169 2513237137 Bacteria 9558895
150 2514012683 2513237161 Bacteria 8871253
151 2517893940 2517572143 Bacteria 9484767
152 2524540710 2524023228 Bacteria 10118060
153 2617379050 2617270741 Bacteria 8201522
154 2728748058 2728368998 Bacteria 8720350
155 2793072817 2791355197 Bacteria 8420563
156 2824683336 2824679649 Bacteria 8248951
157 2838127427 2838122688 Bacteria 8803140
158 2841941620 2841941048 Bacteria 8688029
159 2841952363 2841949485 Bacteria 8680857
160 2841959384 2841957949 Bacteria 8652217
161 2841959385 2841957949 Bacteria 8652217
162 2841967765 2841966195 Bacteria 8673214
163 2841982070 2841974524 Bacteria 8931498
164 2841986388 2841983080 Bacteria 8395090
165 2847934431 2847930680 Bacteria 9342022
166 2879130165 2879127579 Bacteria 8294491
167 2879146680 2879142872 Bacteria 8267021
168 2885389019 2885383462 Bacteria 9473874
169 2888388336 2888388044 Bacteria 7304136
170 2888388337 2888388044 Bacteria 7304136
171 2903774647 2903768456 Bacteria 9749579
172 2904693410 2904690495 Bacteria 9412302
173 2908761927 2908756301 Bacteria 8864324
174 2922394884 2922393267 Bacteria 8285685
175 2922428494
176 2935634480 2935630451 Bacteria 8169952
177 2935796950 2935793552 Bacteria 8012592
178 2941508966 2941507105 Bacteria 8166816
179 2941516795 2941515067 Bacteria 8166720
180 2941525110 2941523033 Bacteria 8169134
181 3005478619 3005474847 Bacteria 9259049
182 3005720831 3005718088 Bacteria 8283608
183 8006927732 8006926726 Bacteria 6749210
184 8006927733 8006926726 Bacteria 6749210
185 8006964876 8006964411 Bacteria 8966052
186 8016628480 8016622563 Bacteria 7999408
187 8019555563 8019547302 Bacteria 7996444
188 Ga0070683_100014355
189 JGI25153J46596_10008457
190 rootH2_10071826
191 rootH1_10040889
192 rootH1_10157021
193 Ga0055529_1004138
194 Ga0055543_1002758
195 Ga0065165_1000626
196 Ga0070683_100405760
197 Ga0068869_100091830
198 Ga0070680_100030827
199 Ga0070680_100327546
200 Ga0070680_100378725
201 Ga0070682_100021272
202 Ga0070660_100361619
203 Ga0070691_10136647
204 Ga0070668_100387624
205 Ga0070667_100185995
206 Ga0070711_100025838
207 Ga0070663_100105342
208 Ga0070681_10113375
209 Ga0070679_100064905
210 Ga0070679_100278829
211 Ga0070684_100149098
212 Ga0068853_100310520
213 Ga0070665_100136129
214 Ga0068855_100232267
215 Ga0068855_100380292
216 Ga0068852_100014961
217 Ga0068852_100268614
218 Ga0068866_10146497
219 Ga0068862_100051923
220 Ga0081455_10058868
221 Ga0081455_10089850
222 Ga0081540_1008486
223 Ga0081540_1032397
224 Ga0075365_10060540
225 Ga0070712_100019058
226 Ga0075362_10041465
227 Ga0075369_10055461
228 Ga0075366_10148510
229 Ga0075370_10130442
230 Ga0099824_1002235
231 Ga0099822_1030154
232 Ga0105240_10007615
233 Ga0105240_10194453
234 Ga0105240_10205432
235 Ga0111539_10765810
236 Ga0105245_10057003
237 Ga0105247_10083193
238 Ga0105241_10054514
239 Ga0105237_10013252
240 Ga0105237_10113717
241 Ga0105237_10631465
242 Ga0105239_10066156
243 Ga0105239_10431155
244 Ga0157370_10135838
245 Ga0163162_10298318
246 Ga0157372_10138396
247 Ga0157375_10700236
248 Ga0157379_10233096
249 Ga0209563_102451
250 Ga0209677_101763
251 Ga0209148_1000673
252 Ga0209455_1006912
253 Ga0209758_1006089
254 Ga0209758_1011397
255 Ga0207654_10030792
256 Ga0207707_10020568
257 Ga0207707_10193827
258 Ga0207695_10000029
259 Ga0207671_10019398
260 Ga0207693_10047654
261 Ga0207652_10092304
262 Ga0207689_10200786
263 Ga0207661_10003384
264 Ga0207661_10039162
265 Ga0207667_10030740
266 Ga0207667_10271861
267 Ga0207668_10206050
268 Ga0207675_100185866
269 Ga0207698_10010793
270 Ga0209589_1000018
271 Ga0209489_100017
272 Ga0209489_100026
273 Ga0209700_100035
274 Ga0268266_10086415
275 Ga0268265_10149568
276 Ga0307509_10329326
277 Ga0265314_10023049
278 Ga0307413_10020967
279 Ga0307411_10188326
280 Ga0315911_1000011
281 Ga0373927_0015680
282 Ga0373925_0057230
283 Ga0395899_0282276
284 Ga0395900_0004267
285 Ga0395898_0077186
286 Ga0395905_0128946
287 Ga0436364_0459666
288 Ga0395901_0102269
289 Ga0395901_0228434
290 Ga0436365_0750436
291 Ga0436360_0876613
292 Ga0466972_0012548
293 Ga0466967_0047799
294 Ga0495638_0092840
295 Ga0495605_0043659
296 Ga0495585_0166511
297 Ga0495594_0130698
298 Ga0495596_0066766
299 Ga0495606_0039703
300 Ga0495610_0088541
301 Ga0495643_0062212
302 Ga0495648_0036423
303 Ga0495648_0143335
304 Ga0495652_0054610
305 Ga0495588_0051764
306 Ga0495671_0083559
307 Ga0495649_0052697
308 Ga0495604_0030189
309 Ga0495676_0125673
310 Ga0495683_0060600
311 Ga0496100_0135081
312 Ga0496102_0188912
313 Ga0496107_0291007
314 Ga0496115_0110259
315 Ga0496121_0050658
316 Ga0496121_0084181
317 Ga0496126_0174891
318 Ga0496126_0211982
319 Ga0495682_0015827
320 nmdc:mga0k408_116003_c1
321 nmdc:mga0sz30_156310_c1
322 Ga0500578_0136967
323 Ga0500583_0139565
324 Ga0500641_0114690
325 Ga0500556_0059408
326 Ga0500595_011282
327 Ga0500658_0072614
328 Ga0500559_0048940
329 Ga0500577_0025502
330 Ga0500588_0079535
331 Ga0500616_0059140
332 Ga0500638_004793
333 Ga0500637_0000520
334 Ga0500599_000807
335 Ga0500661_002784
336 2513858169
337 2514012683
338 2517893940
339 2524540710
340 2617379050
341 2728748058
342 2793072817
343 2824683336
344 2838127427
345 2841941620
346 2841952363
347 2841959384
348 2841959385
349 2841967765
350 2841982070
351 2841986388
352 2847934431
353 2879130165
354 2879146680
355 2885389019
356 2888388336
357 2888388337
358 2903774647
359 2904693410
360 2908761927
361 2922394884
362 2922428494
363 2935634480
364 2935796950
365 2941508966
366 2941516795
367 2941525110
368 3005478619
369 3005720831
370 8006927732
371 8006927733
372 8006964876
373 8016628480
374 8019555563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.6707 204 291
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.6228 204 291
3fwy-assembly1.cif.gz_B crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein 0.5789 77 129
2qww-assembly3.cif.gz_E crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.5781 165 293
2qww-assembly1.cif.gz_A crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.5708 165 293
ID Description Score Start End Superfamily
4em2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7596 201 293 1.10.10.10
af_Q57999_5_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7323 81 120 3.40.50.300
af_P9WME9_3_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7234 200 293 1.10.10.10
af_O05456_89_320_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7125 71 120 3.40.50.300
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6754 204 291 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A432GT73-F1-model_v4 Uncharacterized protein 0.9506 143 204
AF-A0A125QAJ0-F1-model_v4 Uncharacterized protein 0.9469 94 326
AF-A0A125QAJ0-F1-model_v4 Uncharacterized protein 0.939 94 326
AF-A0A151FFP3-F1-model_v4 deleted 0.9298 1 326
AF-A0A0D7NGF8-F1-model_v4 DUF4123 domain-containing protein 0.9287 88 326

Map