F299453

General Info

Members Datasets Scaffolds Average Seq Length
195 86 390 121

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10059388|JGI24740J21852_100593882
Length 127
Sequence MKVQGGCHCQAVRFEAEIPGPPVPALDCNCSVCRMTGYVHINIPHEKFELLTGREALASYRFGTGAAEHLFCRHCGVKSFYQPRSHPGCWSVNANCLDEHVELEVEKFDGRDWAAAKAKLDAGQAGS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 2.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.97
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10059388 3300001979 Bacteria 1060
2 JGI24737J22298_10002763 3300001990 Bacteria 6208
3 rootH1_10228309 3300003323 Bacteria 1329
4 Ga0070658_10024674 3300005327 Bacteria 4821
5 Ga0070658_10110286 3300005327 Bacteria 2279
6 Ga0070683_100011765 3300005329 Bacteria 7577
7 Ga0070670_100766263 3300005331 Unclassified 870
8 Ga0070680_100046426 3300005336 Bacteria 3533
9 Ga0070680_100688370 3300005336 Bacteria 880
10 Ga0070682_100360269 3300005337 Bacteria 1087
11 Ga0070660_100001877 3300005339 Bacteria 14470
12 Ga0070660_100013380 3300005339 Bacteria 5885
13 Ga0070660_100048740 3300005339 Bacteria 3254
14 Ga0070661_100160761 3300005344 Bacteria 1701
15 Ga0070661_100463242 3300005344 Bacteria 1010
16 Ga0070692_10007720 3300005345 Bacteria 4760
17 Ga0070659_100001907 3300005366 Bacteria 14906
18 Ga0070659_100017335 3300005366 Bacteria 5417
19 Ga0070659_100108466 3300005366 Bacteria 2240
20 Ga0070659_100147273 3300005366 Bacteria 1919
21 Ga0070700_100325812 3300005441 Bacteria 1130
22 Ga0070663_100015202 3300005455 Bacteria 4961
23 Ga0070663_100076684 3300005455 Bacteria 2445
24 Ga0070678_100623363 3300005456 Bacteria 965
25 Ga0070662_100022072 3300005457 Bacteria 4353
26 Ga0070679_100024365 3300005530 Bacteria 5929
27 Ga0070679_100166199 3300005530 Bacteria 2180
28 Ga0070679_100456970 3300005530 Bacteria 1222
29 Ga0070679_100804942 3300005530 Bacteria 883
30 Ga0070665_100031999 3300005548 Bacteria 5294
31 Ga0068855_100031760 3300005563 Bacteria 6303
32 Ga0068855_100455813 3300005563 Bacteria 1395
33 Ga0070664_100255239 3300005564 Bacteria 1577
34 Ga0070664_100865525 3300005564 Bacteria 846
35 Ga0068857_100026484 3300005577 Bacteria 5112
36 Ga0068857_101927158 3300005577 Bacteria 579
37 Ga0068856_100350729 3300005614 Bacteria 1494
38 Ga0068856_100739689 3300005614 Bacteria 1003
39 Ga0068852_100017294 3300005616 Bacteria 5653
40 Ga0068852_100837747 3300005616 Bacteria 935
41 Ga0068852_100879533 3300005616 Bacteria 912
42 Ga0081455_10371294 3300005937 Bacteria 1002
43 Ga0105240_10486004 3300009093 Bacteria 1375
44 Ga0157373_10009697 3300013100 Bacteria 7107
45 Ga0157371_10219712 3300013102 Bacteria 1365
46 Ga0157369_10540971 3300013105 Bacteria 1204
47 Ga0157372_11255770 3300013307 Bacteria 855
48 Ga0206354_10971971 3300020081 Bacteria 795
49 Ga0206353_10228841 3300020082 Bacteria 2221
50 Ga0207647_10025078 3300025904 Bacteria 3925
51 Ga0207705_10001285 3300025909 Bacteria 20149
52 Ga0207705_10016106 3300025909 Bacteria 5364
53 Ga0207705_11027320 3300025909 Bacteria 636
54 Ga0207707_10058262 3300025912 Bacteria 3361
55 Ga0207707_10087997 3300025912 Bacteria 2713
56 Ga0207660_10661322 3300025917 Bacteria 852
57 Ga0207660_10848319 3300025917 Bacteria 746
58 Ga0207657_10000143 3300025919 Bacteria 72146
59 Ga0207657_10006165 3300025919 Bacteria 12466
60 Ga0207657_10094714 3300025919 Bacteria 2486
61 Ga0207657_10208095 3300025919 Bacteria 1571
62 Ga0207657_10223392 3300025919 Bacteria 1508
63 Ga0207657_11347204 3300025919 Bacteria 538
64 Ga0207649_10345207 3300025920 Bacteria 1100
65 Ga0207649_10503427 3300025920 Bacteria 921
66 Ga0207652_10043313 3300025921 Bacteria 3833
67 Ga0207652_10139330 3300025921 Bacteria 2168
68 Ga0207652_10239399 3300025921 Bacteria 1636
69 Ga0207681_10015284 3300025923 Bacteria 4786
70 Ga0207694_10207263 3300025924 Bacteria 1596
71 Ga0207650_10595000 3300025925 Unclassified 930
72 Ga0207659_10025392 3300025926 Bacteria 3980
73 Ga0207659_11643926 3300025926 Bacteria 548
74 Ga0207690_10002056 3300025932 Bacteria 12329
75 Ga0207690_10011205 3300025932 Bacteria 5354
76 Ga0207690_10041654 3300025932 Bacteria 3011
77 Ga0207690_10125331 3300025932 Bacteria 1872
78 Ga0207690_10276455 3300025932 Bacteria 1307
79 Ga0207706_10018313 3300025933 Bacteria 6302
80 Ga0207661_10015744 3300025944 Bacteria 5571
81 Ga0207661_10144981 3300025944 Bacteria 2047
82 Ga0207679_10210185 3300025945 Bacteria 1631
83 Ga0207679_10284549 3300025945 Bacteria 1419
84 Ga0207667_10051399 3300025949 Bacteria 4345
85 Ga0207667_10265663 3300025949 Bacteria 1754
86 Ga0207667_11082184 3300025949 Bacteria 786
87 Ga0207640_10025491 3300025981 Bacteria 3580
88 Ga0207639_11399846 3300026041 Bacteria 656
89 Ga0207678_10062089 3300026067 Bacteria 3213
90 Ga0207678_10188667 3300026067 Bacteria 1761
91 Ga0207702_10233332 3300026078 Bacteria 1721
92 Ga0207674_10007642 3300026116 Bacteria 12590
93 Ga0207674_10618632 3300026116 Bacteria 1046
94 Ga0207698_10010941 3300026142 Bacteria 5861
95 Ga0207698_10017200 3300026142 Bacteria 4899
96 Ga0207698_10039213 3300026142 Bacteria 3507
97 Ga0207698_10289224 3300026142 Bacteria 1520
98 Ga0268266_10022961 3300028379 Bacteria 5309
99 Ga0307407_10455380 3300031903 Bacteria 929
100 Ga0307416_100000569 3300032002 Bacteria 18881
101 Ga0307416_100367258 3300032002 Bacteria 1464
102 Ga0307415_100265370 3300032126 Bacteria 1403
103 Ga0373943_0905993 3300035170 Bacteria 527
104 Ga0395899_0000627 3300037312 Bacteria 36773
105 Ga0395899_0021794 3300037312 Bacteria 4860
106 Ga0395899_0145622 3300037312 Bacteria 1682
107 Ga0395899_0164892 3300037312 Bacteria 1563
108 Ga0395899_0232995 3300037312 Bacteria 1270
109 Ga0395899_0430153 3300037312 Bacteria 868
110 Ga0395899_0536755 3300037312 Bacteria 754
111 Ga0395900_0000031 3300037418 Bacteria 262393
112 Ga0395900_0008667 3300037418 Bacteria 10447
113 Ga0395900_0011509 3300037418 Bacteria 9056
114 Ga0395900_0078175 3300037418 Bacteria 3399
115 Ga0395900_0284595 3300037418 Bacteria 1644
116 Ga0395900_1225984 3300037418 Bacteria 665
117 Ga0395900_1458265 3300037418 Bacteria 597
118 Ga0395898_0023732 3300037466 Bacteria 6192
119 Ga0395898_0082511 3300037466 Bacteria 3098
120 Ga0395898_0148168 3300037466 Bacteria 2246
121 Ga0395898_0214115 3300037466 Bacteria 1838
122 Ga0395898_0718818 3300037466 Bacteria 940
123 Ga0395898_0731145 3300037466 Bacteria 931
124 Ga0395898_1491667 3300037466 Bacteria 602
125 Ga0395905_0012288 3300037471 Bacteria 8245
126 Ga0395905_0040671 3300037471 Bacteria 4361
127 Ga0395905_0047087 3300037471 Bacteria 4043
128 Ga0395905_0086327 3300037471 Bacteria 2940
129 Ga0395905_0143024 3300037471 Bacteria 2250
130 Ga0395905_0222960 3300037471 Bacteria 1764
131 Ga0395905_0260069 3300037471 Bacteria 1620
132 Ga0395905_0496711 3300037471 Bacteria 1120
133 Ga0395905_0532266 3300037471 Bacteria 1076
134 Ga0395905_0639567 3300037471 Unclassified 965
135 Ga0395905_0657124 3300037471 Unclassified 950
136 Ga0395905_0870640 3300037471 Bacteria 804
137 Ga0395905_1034774 3300037471 Bacteria 724
138 Ga0436364_0589445 3300037853 Bacteria 513
139 Ga0395901_0000035 3300038443 Bacteria 223888
140 Ga0395901_0021759 3300038443 Bacteria 6570
141 Ga0395901_0038137 3300038443 Bacteria 4970
142 Ga0395901_0175333 3300038443 Bacteria 2249
143 Ga0395901_0340985 3300038443 Bacteria 1548
144 Ga0395901_0368673 3300038443 Bacteria 1479
145 Ga0395901_0447478 3300038443 Bacteria 1321
146 Ga0395901_1138795 3300038443 Bacteria 749
147 Ga0395901_1518354 3300038443 Unclassified 625
148 Ga0439448_0010523 3300042005 Bacteria 2745
149 Ga0439458_0000393 3300042157 Bacteria 10965
150 Ga0466969_0159634 3300044656 Bacteria 1036
151 Ga0466965_0036667 3300044683 Bacteria 2406
152 Ga0466966_0219246 3300044684 Bacteria 1149
153 Ga0466961_0023370 3300044693 Bacteria 3977
154 Ga0466961_0227806 3300044693 Bacteria 1147
155 Ga0466961_0408143 3300044693 Bacteria 824
156 Ga0466963_0006532 3300044694 Bacteria 6906
157 Ga0466963_0007610 3300044694 Bacteria 6467
158 Ga0466963_0048224 3300044694 Bacteria 2813
159 Ga0466963_0070375 3300044694 Bacteria 2353
160 Ga0466963_0246083 3300044694 Bacteria 1254
161 Ga0466964_0003121 3300044706 Bacteria 6023
162 Ga0466964_0038201 3300044706 Bacteria 1930
163 Ga0466971_0001516 3300044719 Bacteria 9787
164 Ga0466971_0024573 3300044719 Bacteria 2688
165 Ga0466971_0102940 3300044719 Bacteria 1313
166 Ga0466970_0091721 3300044765 Bacteria 1649
167 Ga0466970_0161174 3300044765 Bacteria 1241
168 Ga0466970_0254634 3300044765 Bacteria 984
169 Ga0466957_0015167 3300044842 Bacteria 4498
170 Ga0466957_0018293 3300044842 Bacteria 4114
171 Ga0466957_0028779 3300044842 Bacteria 3310
172 Ga0466957_0100771 3300044842 Bacteria 1820
173 Ga0466957_0294891 3300044842 Bacteria 1088
174 Ga0466957_0925653 3300044842 Unclassified 624
175 Ga0466960_0691231 3300044901 Bacteria 611
176 Ga0466959_0016029 3300045049 Bacteria 5469
177 Ga0466959_0056248 3300045049 Bacteria 2871
178 Ga0466959_0332189 3300045049 Bacteria 1038
179 Ga0466958_0419481 3300045836 Bacteria 865
180 Ga0466967_0010022 3300045976 Bacteria 7077
181 Ga0466967_0016741 3300045976 Bacteria 5793
182 Ga0466967_0037420 3300045976 Bacteria 4153
183 Ga0466967_0055762 3300045976 Bacteria 3482
184 Ga0466967_0097982 3300045976 Bacteria 2677
185 Ga0466967_0535207 3300045976 Bacteria 1152
186 Ga0466967_0573167 3300045976 Bacteria 1112
187 Ga0495629_1016671 3300046459 Unclassified 539
188 Ga0495669_0082580 3300046684 Bacteria 1476
189 Ga0501070_0143709 3300049586 Bacteria 1970
190 Ga0501071_0279744 3300049587 Bacteria 1263
191 Ga0501074_0240762 3300049590 Bacteria 1287
192 Ga0587090_023027 3300059510 Bacteria 989
193 Ga0587090_047136 3300059510 Bacteria 778
194 Ga0466962_0002209 3300061719 Bacteria 9197
195 Ga0466962_0091012 3300061719 Bacteria 1461
196 JGI24740J21852_10059388
197 JGI24737J22298_10002763
198 rootH1_10228309
199 Ga0070658_10024674
200 Ga0070658_10110286
201 Ga0070683_100011765
202 Ga0070670_100766263
203 Ga0070680_100046426
204 Ga0070680_100688370
205 Ga0070682_100360269
206 Ga0070660_100001877
207 Ga0070660_100013380
208 Ga0070660_100048740
209 Ga0070661_100160761
210 Ga0070661_100463242
211 Ga0070692_10007720
212 Ga0070659_100001907
213 Ga0070659_100017335
214 Ga0070659_100108466
215 Ga0070659_100147273
216 Ga0070700_100325812
217 Ga0070663_100015202
218 Ga0070663_100076684
219 Ga0070678_100623363
220 Ga0070662_100022072
221 Ga0070679_100024365
222 Ga0070679_100166199
223 Ga0070679_100456970
224 Ga0070679_100804942
225 Ga0070665_100031999
226 Ga0068855_100031760
227 Ga0068855_100455813
228 Ga0070664_100255239
229 Ga0070664_100865525
230 Ga0068857_100026484
231 Ga0068857_101927158
232 Ga0068856_100350729
233 Ga0068856_100739689
234 Ga0068852_100017294
235 Ga0068852_100837747
236 Ga0068852_100879533
237 Ga0081455_10371294
238 Ga0105240_10486004
239 Ga0157373_10009697
240 Ga0157371_10219712
241 Ga0157369_10540971
242 Ga0157372_11255770
243 Ga0206354_10971971
244 Ga0206353_10228841
245 Ga0207647_10025078
246 Ga0207705_10001285
247 Ga0207705_10016106
248 Ga0207705_11027320
249 Ga0207707_10058262
250 Ga0207707_10087997
251 Ga0207660_10661322
252 Ga0207660_10848319
253 Ga0207657_10000143
254 Ga0207657_10006165
255 Ga0207657_10094714
256 Ga0207657_10208095
257 Ga0207657_10223392
258 Ga0207657_11347204
259 Ga0207649_10345207
260 Ga0207649_10503427
261 Ga0207652_10043313
262 Ga0207652_10139330
263 Ga0207652_10239399
264 Ga0207681_10015284
265 Ga0207694_10207263
266 Ga0207650_10595000
267 Ga0207659_10025392
268 Ga0207659_11643926
269 Ga0207690_10002056
270 Ga0207690_10011205
271 Ga0207690_10041654
272 Ga0207690_10125331
273 Ga0207690_10276455
274 Ga0207706_10018313
275 Ga0207661_10015744
276 Ga0207661_10144981
277 Ga0207679_10210185
278 Ga0207679_10284549
279 Ga0207667_10051399
280 Ga0207667_10265663
281 Ga0207667_11082184
282 Ga0207640_10025491
283 Ga0207639_11399846
284 Ga0207678_10062089
285 Ga0207678_10188667
286 Ga0207702_10233332
287 Ga0207674_10007642
288 Ga0207674_10618632
289 Ga0207698_10010941
290 Ga0207698_10017200
291 Ga0207698_10039213
292 Ga0207698_10289224
293 Ga0268266_10022961
294 Ga0307407_10455380
295 Ga0307416_100000569
296 Ga0307416_100367258
297 Ga0307415_100265370
298 Ga0373943_0905993
299 Ga0395899_0000627
300 Ga0395899_0021794
301 Ga0395899_0145622
302 Ga0395899_0164892
303 Ga0395899_0232995
304 Ga0395899_0430153
305 Ga0395899_0536755
306 Ga0395900_0000031
307 Ga0395900_0008667
308 Ga0395900_0011509
309 Ga0395900_0078175
310 Ga0395900_0284595
311 Ga0395900_1225984
312 Ga0395900_1458265
313 Ga0395898_0023732
314 Ga0395898_0082511
315 Ga0395898_0148168
316 Ga0395898_0214115
317 Ga0395898_0718818
318 Ga0395898_0731145
319 Ga0395898_1491667
320 Ga0395905_0012288
321 Ga0395905_0040671
322 Ga0395905_0047087
323 Ga0395905_0086327
324 Ga0395905_0143024
325 Ga0395905_0222960
326 Ga0395905_0260069
327 Ga0395905_0496711
328 Ga0395905_0532266
329 Ga0395905_0639567
330 Ga0395905_0657124
331 Ga0395905_0870640
332 Ga0395905_1034774
333 Ga0436364_0589445
334 Ga0395901_0000035
335 Ga0395901_0021759
336 Ga0395901_0038137
337 Ga0395901_0175333
338 Ga0395901_0340985
339 Ga0395901_0368673
340 Ga0395901_0447478
341 Ga0395901_1138795
342 Ga0395901_1518354
343 Ga0439448_0010523
344 Ga0439458_0000393
345 Ga0466969_0159634
346 Ga0466965_0036667
347 Ga0466966_0219246
348 Ga0466961_0023370
349 Ga0466961_0227806
350 Ga0466961_0408143
351 Ga0466963_0006532
352 Ga0466963_0007610
353 Ga0466963_0048224
354 Ga0466963_0070375
355 Ga0466963_0246083
356 Ga0466964_0003121
357 Ga0466964_0038201
358 Ga0466971_0001516
359 Ga0466971_0024573
360 Ga0466971_0102940
361 Ga0466970_0091721
362 Ga0466970_0161174
363 Ga0466970_0254634
364 Ga0466957_0015167
365 Ga0466957_0018293
366 Ga0466957_0028779
367 Ga0466957_0100771
368 Ga0466957_0294891
369 Ga0466957_0925653
370 Ga0466960_0691231
371 Ga0466959_0016029
372 Ga0466959_0056248
373 Ga0466959_0332189
374 Ga0466958_0419481
375 Ga0466967_0010022
376 Ga0466967_0016741
377 Ga0466967_0037420
378 Ga0466967_0055762
379 Ga0466967_0097982
380 Ga0466967_0535207
381 Ga0466967_0573167
382 Ga0495629_1016671
383 Ga0495669_0082580
384 Ga0501070_0143709
385 Ga0501071_0279744
386 Ga0501074_0240762
387 Ga0587090_023027
388 Ga0587090_047136
389 Ga0466962_0002209
390 Ga0466962_0091012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

26

111

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wac-assembly1.cif.gz_A crystal structure of tarm 0.8113 55 81
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.7756 55 81
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.7342 55 81
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7206 4 113
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.7099 57 81
ID Description Score Start End Superfamily
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.831 4 101 2.170.150.70
af_A0A0P0W298_97_213_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8129 53 90 3.40.420.10
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8075 55 81 3.40.50.2000
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8014 4 101 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8013 3 98 2.170.150.70
ID Description Score Start End GO Terms
AF-I4YR13-F1-model_v4 CENP-V/GFA domain-containing protein 0.8954 41 98 GO:0016846
GO:0046872
AF-A0A0A8TJR4-F1-model_v4 deleted 0.8902 41 100
AF-A0A7H4P4I4-F1-model_v4 Gfa-like protein 0.8817 37 100 GO:0016846
GO:0046872
AF-K7SZS3-F1-model_v4 deleted 0.8798 39 98
AF-A0A4U5NX92-F1-model_v4 CENP-V/GFA domain-containing protein 0.8619 1 99 GO:0016846
GO:0046872

Map