F299344

General Info

Members Datasets Scaffolds Average Seq Length
194 116 388 276

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000630|Ga0500616_0000630_3550_4560
Length 336
Sequence MAIDMETSMCVRATDGWSDPPGSASGTYSHGLVRAPAADLRSTGASIPSGQRTHLWGRGSLVKADAFRFDGKRALVVGGATGMGAAAAELVQELGAEVVVMDHAEVTLAGAKAIKVDLRDRASIDAAVDECGGPIDALFSCAGAADGTPGIEKINFIGHRHLIDRAIDQGYLGRGSSIAMISSAAGLAWEKHLPEIKEYLATPDFDAAVAWIDAHPGKADYMWSKETLCAYVASQALPMLQRGIRINAILPGPTDTPLAQANADLWLAFGSDYRASAGIEASRPDEQAGPLVFLCSDAAAYLNGVTIITDAGYVSSGITGTFPDATPVVDFLYGRY

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
4 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
32 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
33 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
34 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
42 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
43 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
50 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
51 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
52 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
53 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
54 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
55 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
56 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
57 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
58 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
59 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
60 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
61 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
62 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
63 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
112 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 2671180195 Frankia sp. CcI49 Isolate Nodule
115 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
116 2773857922 Frankia sp. CcI49 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0.52
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 2.58
Rhizoplane 5.67
Rhizosphere 79.9
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000630 3300053153 Bacteria 42795
2 Ga0070683_100516246 3300005329 Bacteria 1142
3 Ga0070683_100607123 3300005329 Bacteria 1047
4 Ga0070683_100798061 3300005329 Bacteria 905
5 Ga0070662_100062707 3300005457 Bacteria 2717
6 Ga0070697_100161043 3300005536 Bacteria 1896
7 Ga0081455_10033705 3300005937 Bacteria 4598
8 Ga0081455_10044704 3300005937 Bacteria 3860
9 Ga0081455_10126576 3300005937 Bacteria 2004
10 Ga0081538_10038220 3300005981 Bacteria 3101
11 Ga0081539_10005431 3300005985 Bacteria 13012
12 Ga0075365_10075386 3300006038 Bacteria 2276
13 Ga0075365_10137566 3300006038 Bacteria 1694
14 Ga0075363_100011087 3300006048 Bacteria 4305
15 Ga0075364_10190129 3300006051 Unclassified 1390
16 Ga0075362_10139288 3300006177 Bacteria 1159
17 Ga0075367_10006712 3300006178 Bacteria 5839
18 Ga0075367_10054543 3300006178 Bacteria 2370
19 Ga0075370_10074938 3300006353 Bacteria 1940
20 Ga0075428_100001913 3300006844 Bacteria 22346
21 Ga0075428_100028817 3300006844 Bacteria 6145
22 Ga0075428_100073058 3300006844 Bacteria 3745
23 Ga0075428_100123272 3300006844 Bacteria 2821
24 Ga0075428_100125904 3300006844 Bacteria 2788
25 Ga0075428_100700883 3300006844 Bacteria 1079
26 Ga0075430_100002699 3300006846 Bacteria 14820
27 Ga0075430_100006032 3300006846 Bacteria 10218
28 Ga0075430_100058457 3300006846 Bacteria 3241
29 Ga0075431_100003831 3300006847 Bacteria 14622
30 Ga0075431_100025687 3300006847 Bacteria 6036
31 Ga0075431_100117428 3300006847 Bacteria 2745
32 Ga0075431_100730378 3300006847 Bacteria 966
33 Ga0075429_100002040 3300006880 Bacteria 16815
34 Ga0075429_100026576 3300006880 Bacteria 5027
35 Ga0075429_100056639 3300006880 Bacteria 3412
36 Ga0075429_100344911 3300006880 Bacteria 1304
37 Ga0111539_10001540 3300009094 Bacteria 30701
38 Ga0111539_10499545 3300009094 Bacteria 1417
39 Ga0111539_10535048 3300009094 Bacteria 1365
40 Ga0111539_10800110 3300009094 Bacteria 1097
41 Ga0105245_10043941 3300009098 Bacteria 3987
42 Ga0114129_10057828 3300009147 Bacteria 5425
43 Ga0114129_10121618 3300009147 Bacteria 3592
44 Ga0114129_10182185 3300009147 Bacteria 2857
45 Ga0114129_10294260 3300009147 Bacteria 2166
46 Ga0105242_10023287 3300009176 Bacteria 4882
47 Ga0157378_10028391 3300013297 Bacteria 4936
48 Ga0206351_10176629 3300020077 Bacteria 1221
49 Ga0213876_10059147 3300021384 Bacteria 2023
50 Ga0207681_10056452 3300025923 Bacteria 2679
51 Ga0207687_10019995 3300025927 Bacteria 4441
52 Ga0207691_10064910 3300025940 Bacteria 3306
53 Ga0207428_10004278 3300027907 Bacteria 13659
54 Ga0268265_10106820 3300028380 Bacteria 2275
55 Ga0268264_10124558 3300028381 Bacteria 2276
56 Ga0265339_10064121 3300031249 Bacteria 1972
57 Ga0265327_10001231 3300031251 Bacteria 34376
58 Ga0265327_10006782 3300031251 Bacteria 9036
59 Ga0316579_10176395 3300031691 Bacteria 1033
60 Ga0265314_10275699 3300031711 Bacteria 954
61 Ga0316578_10266066 3300031728 Bacteria 1028
62 Ga0316577_10176434 3300031733 Bacteria 1206
63 Ga0307410_10169806 3300031852 Bacteria 1642
64 Ga0316574_0007117 3300035398 Bacteria 6111
65 Ga0316574_0065132 3300035398 Bacteria 2294
66 Ga0316574_0118514 3300035398 Bacteria 1699
67 Ga0316582_0169319 3300036647 Bacteria 1482
68 Ga0316584_0003670 3300036712 Bacteria 10045
69 Ga0316584_0533268 3300036712 Bacteria 821
70 Ga0436365_1874182 3300039437 Bacteria 3914
71 Ga0436362_0176990 3300039453 Bacteria 3556
72 Ga0439434_0058548 3300042435 Bacteria 1202
73 Ga0466961_0064134 3300044693 Bacteria 2335
74 Ga0466963_0026548 3300044694 Bacteria 3705
75 Ga0466963_0344506 3300044694 Bacteria 1049
76 Ga0466957_0345455 3300044842 Bacteria 1008
77 Ga0466958_0103046 3300045836 Bacteria 1776
78 Ga0466967_0285820 3300045976 Bacteria 1583
79 Ga0495651_0008984 3300046462 Bacteria 7671
80 Ga0495639_0040301 3300046475 Bacteria 2101
81 Ga0495608_0061301 3300046511 Bacteria 2474
82 Ga0495628_0134408 3300046516 Bacteria 1891
83 Ga0495628_0315814 3300046516 Bacteria 1154
84 Ga0495587_0024797 3300046536 Bacteria 3672
85 Ga0495621_0007080 3300046539 Bacteria 3306
86 Ga0495645_0286334 3300046543 Bacteria 1082
87 Ga0495667_0010205 3300046559 Bacteria 6355
88 Ga0495635_0105622 3300046663 Bacteria 1924
89 Ga0495657_0019493 3300046675 Bacteria 4892
90 Ga0495647_0054740 3300046681 Bacteria 1560
91 Ga0495613_0140912 3300046689 Bacteria 1723
92 Ga0495680_0036029 3300047322 Bacteria 3978
93 Ga0495680_0058515 3300047322 Bacteria 2978
94 Ga0495680_0123114 3300047322 Bacteria 1913
95 Ga0495675_0021762 3300047444 Bacteria 4085
96 Ga0495614_0029097 3300048089 Bacteria 2378
97 Ga0496102_0212025 3300048905 Bacteria 1826
98 Ga0496104_0096336 3300048907 Bacteria 2831
99 Ga0496104_0751486 3300048907 Bacteria 882
100 Ga0496105_0412131 3300048908 Bacteria 1071
101 Ga0496106_0158710 3300048909 Bacteria 1788
102 Ga0496109_0325443 3300048912 Bacteria 1451
103 Ga0496110_0027717 3300048913 Bacteria 4858
104 Ga0496111_0104307 3300048914 Bacteria 2086
105 Ga0496114_0076316 3300048917 Bacteria 2824
106 Ga0496114_0561926 3300048917 Bacteria 1008
107 Ga0496115_0071148 3300048918 Bacteria 2821
108 Ga0496126_0000027 3300048929 Bacteria 396518
109 Ga0501032_0217273 3300049569 Bacteria 1245
110 Ga0501033_0000295 3300049570 Bacteria 47954
111 Ga0501033_0005999 3300049570 Bacteria 9532
112 Ga0501034_0000806 3300049571 Bacteria 46584
113 Ga0501034_0012450 3300049571 Bacteria 8785
114 Ga0501034_0213781 3300049571 Bacteria 1883
115 Ga0501036_0144888 3300049572 Bacteria 2004
116 Ga0501037_0018405 3300049573 Bacteria 5149
117 Ga0501041_0052663 3300049577 Bacteria 2481
118 Ga0501043_0034055 3300049579 Bacteria 4007
119 Ga0501046_0015905 3300049580 Bacteria 6310
120 Ga0501047_0004635 3300049581 Bacteria 12936
121 Ga0501048_0030750 3300049582 Bacteria 3886
122 Ga0501067_0177520 3300049583 Bacteria 1186
123 Ga0501068_0006602 3300049584 Bacteria 6401
124 Ga0501068_0058580 3300049584 Bacteria 2337
125 Ga0501069_0000043 3300049585 Bacteria 77795
126 Ga0501069_0014154 3300049585 Bacteria 4259
127 Ga0501069_0015930 3300049585 Bacteria 4031
128 Ga0501070_0000298 3300049586 Bacteria 46144
129 Ga0501070_0000942 3300049586 Bacteria 26254
130 Ga0501070_0016480 3300049586 Bacteria 6209
131 Ga0501070_0039279 3300049586 Bacteria 3948
132 Ga0501071_0003348 3300049587 Bacteria 10017
133 Ga0501072_0081336 3300049588 Bacteria 2567
134 Ga0501073_0000790 3300049589 Bacteria 22536
135 Ga0501073_0003297 3300049589 Bacteria 12127
136 Ga0501073_0137839 3300049589 Bacteria 1691
137 Ga0501074_0001020 3300049590 Bacteria 18229
138 Ga0501074_0163073 3300049590 Bacteria 1592
139 Ga0501075_0244829 3300049591 Bacteria 1367
140 Ga0501080_0001976 3300049742 Bacteria 17683
141 Ga0501080_0011102 3300049742 Bacteria 8243
142 Ga0501080_0033963 3300049742 Bacteria 4762
143 Ga0501080_0064408 3300049742 Bacteria 3409
144 Ga0501080_0130752 3300049742 Bacteria 2324
145 Ga0501081_0109958 3300049743 Bacteria 1955
146 Ga0501083_0001107 3300049744 Bacteria 18047
147 Ga0501083_0023171 3300049744 Bacteria 4308
148 Ga0501083_0087390 3300049744 Bacteria 2061
149 Ga0501044_0004373 3300049823 Bacteria 15815
150 Ga0501044_0062149 3300049823 Bacteria 3818
151 nmdc:mga03n38_82512_c1 3300050490 Unclassified 1513
152 nmdc:mga00v17_174002_c1 3300050491 Bacteria 1389
153 nmdc:mga00v17_8205_c1 3300050491 Bacteria 5614
154 nmdc:mga00v17_92539_c1 3300050491 Bacteria 1901
155 nmdc:mga0yw44_261994_c1 3300050492 Bacteria 1152
156 nmdc:mga0yw44_6815_c1 3300050492 Bacteria 5554
157 nmdc:mga04h51_40614_c1 3300050495 Bacteria 1517
158 nmdc:mga07m45_198117_c1 3300050496 Bacteria 1168
159 nmdc:mga05p37_155276_c1 3300050507 Bacteria 2797
160 nmdc:mga05p37_344420_c1 3300050507 Bacteria 1756
161 nmdc:mga05p37_77591_c1 3300050507 Bacteria 4090
162 nmdc:mga05p37_783708_c1 3300050507 Bacteria 1046
163 nmdc:mga05p37_913_c1 3300050507 Bacteria 33348
164 nmdc:mga09592_1473_c1 3300050508 Bacteria 18914
165 nmdc:mga09592_196719_c1 3300050508 Bacteria 1745
166 nmdc:mga09592_594_c1 3300050508 Bacteria 27417
167 nmdc:mga09592_82628_c1 3300050508 Bacteria 2737
168 nmdc:mga0qj67_104055_c1 3300050509 Bacteria 2290
169 nmdc:mga0qj67_1880_c1 3300050509 Bacteria 14892
170 nmdc:mga0qj67_283_c1 3300050509 Bacteria 35322
171 nmdc:mga06r32_44137_c1 3300050510 Bacteria 4244
172 nmdc:mga06r32_5515_c1 3300050510 Bacteria 11400
173 nmdc:mga06r32_585448_c1 3300050510 Bacteria 1088
174 nmdc:mga06r32_7652_c1 3300050510 Bacteria 9715
175 nmdc:mga08y16_184296_c1 3300050511 Bacteria 2167
176 nmdc:mga08y16_204239_c1 3300050511 Bacteria 2047
177 nmdc:mga08y16_358035_c1 3300050511 Bacteria 1498
178 nmdc:mga08y16_562047_c1 3300050511 Bacteria 1153
179 nmdc:mga08y16_584675_c1 3300050511 Bacteria 1127
180 Ga0495595_0013218 3300053084 Bacteria 3485
181 Ga0495595_0227213 3300053084 Bacteria 932
182 Ga0500566_0000083 3300053094 Bacteria 46619
183 Ga0500568_0000037 3300053139 Bacteria 135208
184 Ga0500616_0005696 3300053153 Bacteria 8396
185 Ga0501084_0009774 3300054114 Bacteria 7931
186 Ga0590075_033003 3300059424 Bacteria 1314
187 Ga0590077_017398 3300059426 Bacteria 1512
188 Ga0501082_0033753 3300060353 Bacteria 4414
189 Ga0501082_0845200 3300060353 Bacteria 801
190 2671840298 2671180195 Bacteria 9757215
191 2689990967 2687453743 Bacteria 8361025
192 2689993587 2687453743 Bacteria 8361025
193 2689994269 2687453743 Bacteria 8361025
194 2774858454 2773857922 Bacteria 9757215
195 Ga0500616_0000630
196 Ga0070683_100516246
197 Ga0070683_100607123
198 Ga0070683_100798061
199 Ga0070662_100062707
200 Ga0070697_100161043
201 Ga0081455_10033705
202 Ga0081455_10044704
203 Ga0081455_10126576
204 Ga0081538_10038220
205 Ga0081539_10005431
206 Ga0075365_10075386
207 Ga0075365_10137566
208 Ga0075363_100011087
209 Ga0075364_10190129
210 Ga0075362_10139288
211 Ga0075367_10006712
212 Ga0075367_10054543
213 Ga0075370_10074938
214 Ga0075428_100001913
215 Ga0075428_100028817
216 Ga0075428_100073058
217 Ga0075428_100123272
218 Ga0075428_100125904
219 Ga0075428_100700883
220 Ga0075430_100002699
221 Ga0075430_100006032
222 Ga0075430_100058457
223 Ga0075431_100003831
224 Ga0075431_100025687
225 Ga0075431_100117428
226 Ga0075431_100730378
227 Ga0075429_100002040
228 Ga0075429_100026576
229 Ga0075429_100056639
230 Ga0075429_100344911
231 Ga0111539_10001540
232 Ga0111539_10499545
233 Ga0111539_10535048
234 Ga0111539_10800110
235 Ga0105245_10043941
236 Ga0114129_10057828
237 Ga0114129_10121618
238 Ga0114129_10182185
239 Ga0114129_10294260
240 Ga0105242_10023287
241 Ga0157378_10028391
242 Ga0206351_10176629
243 Ga0213876_10059147
244 Ga0207681_10056452
245 Ga0207687_10019995
246 Ga0207691_10064910
247 Ga0207428_10004278
248 Ga0268265_10106820
249 Ga0268264_10124558
250 Ga0265339_10064121
251 Ga0265327_10001231
252 Ga0265327_10006782
253 Ga0316579_10176395
254 Ga0265314_10275699
255 Ga0316578_10266066
256 Ga0316577_10176434
257 Ga0307410_10169806
258 Ga0316574_0007117
259 Ga0316574_0065132
260 Ga0316574_0118514
261 Ga0316582_0169319
262 Ga0316584_0003670
263 Ga0316584_0533268
264 Ga0436365_1874182
265 Ga0436362_0176990
266 Ga0439434_0058548
267 Ga0466961_0064134
268 Ga0466963_0026548
269 Ga0466963_0344506
270 Ga0466957_0345455
271 Ga0466958_0103046
272 Ga0466967_0285820
273 Ga0495651_0008984
274 Ga0495639_0040301
275 Ga0495608_0061301
276 Ga0495628_0134408
277 Ga0495628_0315814
278 Ga0495587_0024797
279 Ga0495621_0007080
280 Ga0495645_0286334
281 Ga0495667_0010205
282 Ga0495635_0105622
283 Ga0495657_0019493
284 Ga0495647_0054740
285 Ga0495613_0140912
286 Ga0495680_0036029
287 Ga0495680_0058515
288 Ga0495680_0123114
289 Ga0495675_0021762
290 Ga0495614_0029097
291 Ga0496102_0212025
292 Ga0496104_0096336
293 Ga0496104_0751486
294 Ga0496105_0412131
295 Ga0496106_0158710
296 Ga0496109_0325443
297 Ga0496110_0027717
298 Ga0496111_0104307
299 Ga0496114_0076316
300 Ga0496114_0561926
301 Ga0496115_0071148
302 Ga0496126_0000027
303 Ga0501032_0217273
304 Ga0501033_0000295
305 Ga0501033_0005999
306 Ga0501034_0000806
307 Ga0501034_0012450
308 Ga0501034_0213781
309 Ga0501036_0144888
310 Ga0501037_0018405
311 Ga0501041_0052663
312 Ga0501043_0034055
313 Ga0501046_0015905
314 Ga0501047_0004635
315 Ga0501048_0030750
316 Ga0501067_0177520
317 Ga0501068_0006602
318 Ga0501068_0058580
319 Ga0501069_0000043
320 Ga0501069_0014154
321 Ga0501069_0015930
322 Ga0501070_0000298
323 Ga0501070_0000942
324 Ga0501070_0016480
325 Ga0501070_0039279
326 Ga0501071_0003348
327 Ga0501072_0081336
328 Ga0501073_0000790
329 Ga0501073_0003297
330 Ga0501073_0137839
331 Ga0501074_0001020
332 Ga0501074_0163073
333 Ga0501075_0244829
334 Ga0501080_0001976
335 Ga0501080_0011102
336 Ga0501080_0033963
337 Ga0501080_0064408
338 Ga0501080_0130752
339 Ga0501081_0109958
340 Ga0501083_0001107
341 Ga0501083_0023171
342 Ga0501083_0087390
343 Ga0501044_0004373
344 Ga0501044_0062149
345 nmdc:mga03n38_82512_c1
346 nmdc:mga00v17_174002_c1
347 nmdc:mga00v17_8205_c1
348 nmdc:mga00v17_92539_c1
349 nmdc:mga0yw44_261994_c1
350 nmdc:mga0yw44_6815_c1
351 nmdc:mga04h51_40614_c1
352 nmdc:mga07m45_198117_c1
353 nmdc:mga05p37_155276_c1
354 nmdc:mga05p37_344420_c1
355 nmdc:mga05p37_77591_c1
356 nmdc:mga05p37_783708_c1
357 nmdc:mga05p37_913_c1
358 nmdc:mga09592_1473_c1
359 nmdc:mga09592_196719_c1
360 nmdc:mga09592_594_c1
361 nmdc:mga09592_82628_c1
362 nmdc:mga0qj67_104055_c1
363 nmdc:mga0qj67_1880_c1
364 nmdc:mga0qj67_283_c1
365 nmdc:mga06r32_44137_c1
366 nmdc:mga06r32_5515_c1
367 nmdc:mga06r32_585448_c1
368 nmdc:mga06r32_7652_c1
369 nmdc:mga08y16_184296_c1
370 nmdc:mga08y16_204239_c1
371 nmdc:mga08y16_358035_c1
372 nmdc:mga08y16_562047_c1
373 nmdc:mga08y16_584675_c1
374 Ga0495595_0013218
375 Ga0495595_0227213
376 Ga0500566_0000083
377 Ga0500568_0000037
378 Ga0500616_0005696
379 Ga0501084_0009774
380 Ga0590075_033003
381 Ga0590077_017398
382 Ga0501082_0033753
383 Ga0501082_0845200
384 2671840298
385 2689990967
386 2689993587
387 2689994269
388 2774858454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

206

314

0.86

PF00106

adh_short

short chain dehydrogenase

72

202

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

74

207

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1l-assembly1.cif.gz_A crystal structure of a c-terminal trunacted mutant of a putative ketoacyl reductase (fabg4) from mycobacterium tuberculosis h37rv at 2.5 angstrom resolution 0.8351 5 249
1uzm-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.8348 11 252
1uzl-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.8262 11 252
2ntn-assembly1.cif.gz_A-2 crystal structure of maba-c60v/g139a/s144l 0.8249 11 252
1uzm-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.8223 11 252
ID Description Score Start End Superfamily
4emjA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8366 7 40 3.50.50.60
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8267 6 126 3.40.50.720
af_P9WHH3_154_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8216 11 54 3.50.50.60
2fwmX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8168 7 252 3.40.50.720
3m1lB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8159 2 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A800FA51-F1-model_v4 SDR family oxidoreductase 0.9869 7 260 GO:0016491
AF-A0A349SU54-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9831 1 274 GO:0016491
AF-A0A2D9TX30-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9819 1 275 GO:0016620
AF-A0A1A3AKX4-F1-model_v4 Short-chain dehydrogenase 0.9799 4 274 GO:0016491
AF-A0A800FA51-F1-model_v4 SDR family oxidoreductase 0.9792 7 260 GO:0016491

Map