F298992

General Info

Members Datasets Scaffolds Average Seq Length
194 132 190 337

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_0542036|Ga0451807_0542036_364_1584
Length 380
Sequence MILAGVVAQRIRARADHQHAALHQVRVASGAAPFPPQPQDMPMRLLPTLLTAACSPDADTATGFAAVGQLTRYDPAFAEVVDAAARIEKLTGDEFTWSEGPTWIADGAYLLFTDVPENRMYRWSQADGLSVFLDPSGYAGPPLATIREGGANGLYAEAAGTVLLADSGNRLVARLDPAKKTRTTLAERFEGKRFNSPNDVVARSDGAVFFTDPPYGLTDGNDSPAKELKTNGVYRIDVNGSVHLLDDSLSSPNGIALSPDGNTLYVSNSDPQRPIWMAYTLDAAGNVTDKRQFADASDLMGEGVQGLPDGLTVSSEGLLFATGPGGVLVLDAAGKRLGRIETGSAIANCAFGDDGRTLYMTSHKFLARVPLKVAGPGFQN

Samples

Sample ID Description Type Environment
1 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
2 2919513703 Luteimonas sp. 3794 Isolate Unclassified
3 2919675420 Luteimonas terrae 4099 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
132 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 4.12
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10052819 3300003322 Bacteria 2630
2 rootH1_10148537 3300003323 Unclassified 1414
3 Ga0070690_100008784 3300005330 Bacteria 5833
4 Ga0070677_10002635 3300005333 Bacteria 5739
5 Ga0070677_10004394 3300005333 Bacteria 4600
6 Ga0068869_100126997 3300005334 Bacteria 1957
7 Ga0068869_100282714 3300005334 Bacteria 1334
8 Ga0070680_100120264 3300005336 Bacteria 2192
9 Ga0070682_100012301 3300005337 Bacteria 4904
10 Ga0070682_100046343 3300005337 Bacteria 2697
11 Ga0070689_100000019 3300005340 Bacteria 149968
12 Ga0070689_100070129 3300005340 Bacteria 2736
13 Ga0070668_100032141 3300005347 Bacteria 3994
14 Ga0070668_100033652 3300005347 Bacteria 3904
15 Ga0070669_100009130 3300005353 Bacteria 7068
16 Ga0070669_100333943 3300005353 Bacteria 1227
17 Ga0070675_100052622 3300005354 Bacteria 3348
18 Ga0070675_100078505 3300005354 Bacteria 2749
19 Ga0070675_100104001 3300005354 Bacteria 2395
20 Ga0070675_100136692 3300005354 Bacteria 2092
21 Ga0070674_100041193 3300005356 Bacteria 3128
22 Ga0070673_100011904 3300005364 Bacteria 5958
23 Ga0070710_10142074 3300005437 Bacteria 1473
24 Ga0070705_100011663 3300005440 Bacteria 4442
25 Ga0070700_100230533 3300005441 Bacteria 1318
26 Ga0070694_100046197 3300005444 Bacteria 2922
27 Ga0070678_100140535 3300005456 Bacteria 1932
28 Ga0070662_100000818 3300005457 Bacteria 19179
29 Ga0070681_10144059 3300005458 Bacteria 2312
30 Ga0068867_100160408 3300005459 Bacteria 1773
31 Ga0070685_10075855 3300005466 Bacteria 2004
32 Ga0070685_10127024 3300005466 Bacteria 1590
33 Ga0070679_100126711 3300005530 Bacteria 2536
34 Ga0070672_100036903 3300005543 Bacteria 3727
35 Ga0070672_100038335 3300005543 Bacteria 3661
36 Ga0070686_100010420 3300005544 Bacteria 5241
37 Ga0070665_100446825 3300005548 Bacteria 1302
38 Ga0070664_100030943 3300005564 Bacteria 4468
39 Ga0068857_100184276 3300005577 Bacteria 1900
40 Ga0070702_100134060 3300005615 Bacteria 1568
41 Ga0068859_100050940 3300005617 Bacteria 4161
42 Ga0068859_100071115 3300005617 Bacteria 3515
43 Ga0068861_100000294 3300005719 Bacteria 27986
44 Ga0068861_100010485 3300005719 Bacteria 6432
45 Ga0068861_100016454 3300005719 Bacteria 5234
46 Ga0068870_10001223 3300005840 Bacteria 10330
47 Ga0068870_10019931 3300005840 Bacteria 3258
48 Ga0068863_100042965 3300005841 Bacteria 4293
49 Ga0068863_100092280 3300005841 Bacteria 2873
50 Ga0068863_100094273 3300005841 Bacteria 2841
51 Ga0068863_100360287 3300005841 Unclassified 1417
52 Ga0068858_100079466 3300005842 Bacteria 3048
53 Ga0068862_100000378 3300005844 Bacteria 48343
54 Ga0068862_100045022 3300005844 Bacteria 3764
55 Ga0068862_100202899 3300005844 Unclassified 1789
56 Ga0081455_10006925 3300005937 Bacteria 12058
57 Ga0075364_10018862 3300006051 Bacteria 4326
58 Ga0097621_100101630 3300006237 Bacteria 2419
59 Ga0097621_100309747 3300006237 Unclassified 1396
60 Ga0068871_100089199 3300006358 Bacteria 2566
61 Ga0068871_100237685 3300006358 Bacteria 1583
62 Ga0068871_100239613 3300006358 Bacteria 1576
63 Ga0068871_100337781 3300006358 Unclassified 1329
64 Ga0075428_100050641 3300006844 Bacteria 4554
65 Ga0075428_100075605 3300006844 Bacteria 3678
66 Ga0075431_100369753 3300006847 Bacteria 1439
67 Ga0068865_100011968 3300006881 Bacteria 5449
68 Ga0097620_100050942 3300006931 Bacteria 4161
69 Ga0097620_100071113 3300006931 Bacteria 3515
70 Ga0111539_10175222 3300009094 Bacteria 2505
71 Ga0111539_10178556 3300009094 Bacteria 2480
72 Ga0111539_10315711 3300009094 Bacteria 1819
73 Ga0114129_10183183 3300009147 Bacteria 2848
74 Ga0105242_10208375 3300009176 Unclassified 1740
75 Ga0105249_10218356 3300009553 Unclassified 1875
76 Ga0163163_10049353 3300014325 Bacteria 4141
77 Ga0157380_10036404 3300014326 Bacteria 3807
78 Ga0157380_10122030 3300014326 Bacteria 2209
79 Ga0157379_10382671 3300014968 Bacteria 1291
80 Ga0157376_10063009 3300014969 Bacteria 3122
81 Ga0163161_10220448 3300017792 Bacteria 1469
82 Ga0207682_10002967 3300025893 Bacteria 7446
83 Ga0207682_10003471 3300025893 Bacteria 6833
84 Ga0207692_10119277 3300025898 Bacteria 1475
85 Ga0207645_10050538 3300025907 Bacteria 2655
86 Ga0207645_10070073 3300025907 Bacteria 2243
87 Ga0207643_10006182 3300025908 Bacteria 6408
88 Ga0207643_10060051 3300025908 Bacteria 2170
89 Ga0207707_10043876 3300025912 Bacteria 3899
90 Ga0207681_10069214 3300025923 Bacteria 2454
91 Ga0207706_10001531 3300025933 Bacteria 22948
92 Ga0207706_10296278 3300025933 Bacteria 1410
93 Ga0207670_10000013 3300025936 Bacteria 211834
94 Ga0207670_10237366 3300025936 Bacteria 1403
95 Ga0207670_10251266 3300025936 Unclassified 1367
96 Ga0207669_10031732 3300025937 Bacteria 2956
97 Ga0207669_10114998 3300025937 Bacteria 1812
98 Ga0207691_10002796 3300025940 Bacteria 17020
99 Ga0207691_10008395 3300025940 Bacteria 9925
100 Ga0207691_10078649 3300025940 Bacteria 2969
101 Ga0207689_10082428 3300025942 Bacteria 2644
102 Ga0207689_10087326 3300025942 Bacteria 2562
103 Ga0207689_10284380 3300025942 Bacteria 1369
104 Ga0207712_10009337 3300025961 Bacteria 6205
105 Ga0207668_10013011 3300025972 Bacteria 5113
106 Ga0207668_10022589 3300025972 Bacteria 4030
107 Ga0207668_10032981 3300025972 Bacteria 3428
108 Ga0207658_10319755 3300025986 Bacteria 1343
109 Ga0207678_10194869 3300026067 Bacteria 1732
110 Ga0207678_10202900 3300026067 Bacteria 1696
111 Ga0207708_10005774 3300026075 Bacteria 9148
112 Ga0207708_10051061 3300026075 Bacteria 3148
113 Ga0207708_10282106 3300026075 Bacteria 1346
114 Ga0207641_10018211 3300026088 Bacteria 5757
115 Ga0207674_10146595 3300026116 Bacteria 2319
116 Ga0207674_10181947 3300026116 Bacteria 2053
117 Ga0207675_100000344 3300026118 Bacteria 44314
118 Ga0207675_100005554 3300026118 Bacteria 12068
119 Ga0207675_100017826 3300026118 Bacteria 6625
120 Ga0207675_100301016 3300026118 Bacteria 1562
121 Ga0207683_10011668 3300026121 Bacteria 7500
122 Ga0207683_10024907 3300026121 Bacteria 5157
123 Ga0207428_10259918 3300027907 Bacteria 1293
124 Ga0268266_10131844 3300028379 Bacteria 2236
125 Ga0268265_10000790 3300028380 Bacteria 30194
126 Ga0307513_10005109 3300031456 Bacteria 17369
127 Ga0307513_10051296 3300031456 Bacteria 4452
128 Ga0307509_10022680 3300031507 Bacteria 7071
129 Ga0307408_100077710 3300031548 Bacteria 2472
130 Ga0307413_10036912 3300031824 Bacteria 2818
131 Ga0307413_10080879 3300031824 Bacteria 2081
132 Ga0307410_10002380 3300031852 Bacteria 9069
133 Ga0307410_10021023 3300031852 Bacteria 4006
134 Ga0307406_10055727 3300031901 Bacteria 2528
135 Ga0307407_10011202 3300031903 Bacteria 4257
136 Ga0307407_10080708 3300031903 Bacteria 1966
137 Ga0307412_10105263 3300031911 Bacteria 2004
138 Ga0307409_100003665 3300031995 Bacteria 8408
139 Ga0307409_100178704 3300031995 Bacteria 1876
140 Ga0307416_100054417 3300032002 Bacteria 3217
141 Ga0307414_10002438 3300032004 Bacteria 9725
142 Ga0307414_10220736 3300032004 Unclassified 1556
143 Ga0307411_10039693 3300032005 Bacteria 2979
144 Ga0307415_100039304 3300032126 Bacteria 3126
145 Ga0373950_0000003 3300034818 Bacteria 541085
146 Ga0373954_0061934 3300035118 Bacteria 1767
147 Ga0400483_277180 3300039062 Unclassified 1613
148 Ga0451791_0586226 3300041451 Unclassified 1381
149 Ga0451797_1332563 3300041453 Bacteria 1524
150 Ga0451795_1713492 3300041456 Bacteria 2476
151 Ga0451802_0922970 3300041460 Bacteria 2907
152 Ga0451807_0542036 3300041486 Bacteria 3675
153 Ga0451807_1413778 3300041486 Bacteria 2237
154 Ga0451807_2607721 3300041486 Bacteria 3505
155 Ga0451837_0452642 3300041494 Bacteria 3232
156 Ga0451853_0292669 3300041512 Bacteria 1930
157 Ga0439448_0037926 3300042005 Bacteria 1550
158 Ga0495590_0005962 3300046457 Bacteria 4776
159 Ga0495638_0011112 3300046460 Bacteria 6220
160 Ga0495632_0027280 3300046519 Bacteria 2993
161 Ga0495632_0069949 3300046519 Bacteria 1689
162 Ga0495656_0110047 3300046615 Bacteria 1287
163 Ga0495668_0017988 3300046616 Bacteria 4092
164 Ga0495625_0013468 3300046660 Bacteria 6571
165 Ga0495649_0001447 3300046694 Bacteria 17893
166 Ga0495649_0039955 3300046694 Bacteria 2571
167 Ga0496114_0083733 3300048917 Unclassified 2699
168 Ga0496122_0019214 3300048925 Bacteria 6254
169 Ga0496123_0012477 3300048926 Bacteria 7242
170 Ga0495678_055003 3300049459 Bacteria 1521
171 Ga0501038_0223161 3300049574 Bacteria 1503
172 Ga0501039_0090415 3300049575 Bacteria 2386
173 Ga0501067_0000369 3300049583 Bacteria 24624
174 Ga0501067_0057183 3300049583 Bacteria 2160
175 Ga0501068_0001490 3300049584 Bacteria 12461
176 Ga0501070_0035801 3300049586 Bacteria 4146
177 Ga0501071_0012334 3300049587 Bacteria 5795
178 Ga0501073_0005490 3300049589 Bacteria 9499
179 Ga0501074_0004546 3300049590 Bacteria 9930
180 Ga0501075_0044553 3300049591 Bacteria 3329
181 Ga0501076_0012431 3300049592 Bacteria 6363
182 Ga0501077_0040820 3300049593 Bacteria 2954
183 Ga0501245_021668 3300049708 Unclassified 1010
184 Ga0501079_0106042 3300049741 Bacteria 2180
185 Ga0501080_0032790 3300049742 Bacteria 4845
186 Ga0501083_0029092 3300049744 Bacteria 3804
187 nmdc:mga00v17_105680_c1 3300050491 Bacteria 1782
188 nmdc:mga00v17_38752_c1 3300050491 Bacteria 2851
189 nmdc:mga08y16_62681_c1 3300050511 Bacteria 3883
190 Ga0500637_0002574 3300053178 Bacteria 8104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100071115 Ga0068859_1000711152 301
2 3300006931 Ga0097620_100071113 Ga0097620_1000711132 301
3 3300046660 Ga0495625_0013468 Ga0495625_0013468_5653_6558 301
4 3300049708 Ga0501245_021668 Ga0501245_021668_22_948 304
5 iso_pu_bacteria 2919513703 2919516586 315
6 3300049583 Ga0501067_0057183 Ga0501067_0057183_1090_2139 316
7 3300042005 Ga0439448_0037926 Ga0439448_0037926_189_1148 317
8 3300048925 Ga0496122_0019214 Ga0496122_0019214_1558_2610 317
9 3300048926 Ga0496123_0012477 Ga0496123_0012477_1621_2673 317
10 3300034818 Ga0373950_0000003 Ga0373950_0000003_187833_188885 318
11 3300049583 Ga0501067_0000369 Ga0501067_0000369_7302_8354 318
12 3300049589 Ga0501073_0005490 Ga0501073_0005490_7503_8555 318
13 3300005347 Ga0070668_100032141 Ga0070668_1000321412 319
14 3300025972 Ga0207668_10022589 Ga0207668_100225892 319
15 3300025942 Ga0207689_10082428 Ga0207689_100824281 320
16 3300026075 Ga0207708_10051061 Ga0207708_100510612 320
17 3300005334 Ga0068869_100126997 Ga0068869_1001269972 321
18 3300025942 Ga0207689_10087326 Ga0207689_100873262 321
19 3300031456 Ga0307513_10005109 Ga0307513_1000510910 321
20 3300053178 Ga0500637_0002574 Ga0500637_0002574_2830_3864 322
21 3300005543 Ga0070672_100036903 Ga0070672_1000369033 325
22 3300005841 Ga0068863_100042965 Ga0068863_1000429653 325
23 3300026088 Ga0207641_10018211 Ga0207641_100182114 325
24 3300041486 Ga0451807_2607721 Ga0451807_2607721_116_1171 325
25 3300014969 Ga0157376_10063009 Ga0157376_100630092 326
26 3300005336 Ga0070680_100120264 Ga0070680_1001202642 327
27 3300005347 Ga0070668_100033652 Ga0070668_1000336523 327
28 3300005353 Ga0070669_100009130 Ga0070669_1000091303 327
29 3300005444 Ga0070694_100046197 Ga0070694_1000461972 327
30 3300005457 Ga0070662_100000818 Ga0070662_10000081810 327
31 3300005458 Ga0070681_10144059 Ga0070681_101440592 327
32 3300005577 Ga0068857_100184276 Ga0068857_1001842761 327
33 3300005615 Ga0070702_100134060 Ga0070702_1001340602 327
34 3300005719 Ga0068861_100000294 Ga0068861_10000029411 327
35 3300005844 Ga0068862_100000378 Ga0068862_10000037818 327
36 3300006844 Ga0075428_100075605 Ga0075428_1000756052 327
37 3300006847 Ga0075431_100369753 Ga0075431_1003697532 327
38 3300009094 Ga0111539_10178556 Ga0111539_101785562 327
39 3300009147 Ga0114129_10183183 Ga0114129_101831833 327
40 3300025907 Ga0207645_10050538 Ga0207645_100505382 327
41 3300025912 Ga0207707_10043876 Ga0207707_100438763 327
42 3300025923 Ga0207681_10069214 Ga0207681_100692142 327
43 3300025933 Ga0207706_10001531 Ga0207706_100015318 327
44 3300025961 Ga0207712_10009337 Ga0207712_100093372 327
45 3300025972 Ga0207668_10032981 Ga0207668_100329812 327
46 3300026116 Ga0207674_10146595 Ga0207674_101465952 327
47 3300026118 Ga0207675_100000344 Ga0207675_10000034433 327
48 3300028380 Ga0268265_10000790 Ga0268265_100007909 327
49 3300041451 Ga0451791_0586226 Ga0451791_0586226_145_1140 327
50 3300039062 Ga0400483_277180 Ga0400483_277180_279_1292 328
51 3300005333 Ga0070677_10002635 Ga0070677_100026354 329
52 3300005354 Ga0070675_100078505 Ga0070675_1000785053 329
53 3300005364 Ga0070673_100011904 Ga0070673_1000119042 329
54 3300005466 Ga0070685_10075855 Ga0070685_100758552 329
55 3300005564 Ga0070664_100030943 Ga0070664_1000309433 329
56 3300005840 Ga0068870_10001223 Ga0068870_100012235 329
57 3300009553 Ga0105249_10218356 Ga0105249_102183562 329
58 3300014326 Ga0157380_10122030 Ga0157380_101220302 329
59 3300025893 Ga0207682_10003471 Ga0207682_100034712 329
60 3300025908 Ga0207643_10006182 Ga0207643_100061823 329
61 3300025937 Ga0207669_10114998 Ga0207669_101149982 329
62 3300025940 Ga0207691_10008395 Ga0207691_100083952 329
63 3300026067 Ga0207678_10194869 Ga0207678_101948692 329
64 3300026121 Ga0207683_10011668 Ga0207683_1001166810 329
65 3300031456 Ga0307513_10051296 Ga0307513_100512964 329
66 3300046694 Ga0495649_0001447 Ga0495649_0001447_12777_13766 329
67 3300003323 rootH1_10148537 rootH1_101485372 330
68 3300025972 Ga0207668_10013011 Ga0207668_100130115 331
69 3300041486 Ga0451807_0542036 Ga0451807_0542036_364_1584 331
70 3300005353 Ga0070669_100333943 Ga0070669_1003339432 332
71 3300005354 Ga0070675_100052622 Ga0070675_1000526222 332
72 3300009094 Ga0111539_10315711 Ga0111539_103157112 332
73 3300025940 Ga0207691_10078649 Ga0207691_100786492 332
74 3300005530 Ga0070679_100126711 Ga0070679_1001267112 334
75 3300046615 Ga0495656_0110047 Ga0495656_0110047_211_1236 334
76 iso_pu_bacteria 8002869464 8002870010 334
77 3300005334 Ga0068869_100282714 Ga0068869_1002827142 335
78 3300005340 Ga0070689_100000019 Ga0070689_100000019100 335
79 3300005354 Ga0070675_100136692 Ga0070675_1001366922 335
80 3300005841 Ga0068863_100094273 Ga0068863_1000942732 335
81 3300005841 Ga0068863_100360287 Ga0068863_1003602872 335
82 3300006237 Ga0097621_100101630 Ga0097621_1001016302 335
83 3300006358 Ga0068871_100089199 Ga0068871_1000891992 335
84 3300006844 Ga0075428_100050641 Ga0075428_1000506415 335
85 3300006881 Ga0068865_100011968 Ga0068865_1000119682 335
86 3300009176 Ga0105242_10208375 Ga0105242_102083752 335
87 3300014968 Ga0157379_10382671 Ga0157379_103826712 335
88 3300017792 Ga0163161_10220448 Ga0163161_102204482 335
89 3300025936 Ga0207670_10000013 Ga0207670_1000001383 335
90 3300025942 Ga0207689_10284380 Ga0207689_102843801 335
91 3300026118 Ga0207675_100301016 Ga0207675_1003010162 335
92 3300041460 Ga0451802_0922970 Ga0451802_0922970_590_1690 335
93 3300046457 Ga0495590_0005962 Ga0495590_0005962_2832_3869 335
94 3300046519 Ga0495632_0027280 Ga0495632_0027280_984_2021 335
95 3300046616 Ga0495668_0017988 Ga0495668_0017988_2506_3543 335
96 3300046694 Ga0495649_0039955 Ga0495649_0039955_1183_2220 335
97 3300049459 Ga0495678_055003 Ga0495678_055003_261_1298 335
98 iso_pu_bacteria 2894414249 2894416934 335
99 iso_pu_bacteria 2919675420 2919675662 335
100 3300005548 Ga0070665_100446825 Ga0070665_1004468251 336
101 3300006051 Ga0075364_10018862 Ga0075364_100188625 336
102 3300028379 Ga0268266_10131844 Ga0268266_101318441 336
103 3300041453 Ga0451797_1332563 Ga0451797_1332563_455_1495 336
104 3300041456 Ga0451795_1713492 Ga0451795_1713492_647_1681 336
105 3300046460 Ga0495638_0011112 Ga0495638_0011112_463_1530 336
106 3300050491 nmdc:mga00v17_38752_c1 nmdc:mga00v17_38752_c1_457_1503 336
107 3300031824 Ga0307413_10080879 Ga0307413_100808792 337
108 3300031852 Ga0307410_10021023 Ga0307410_100210233 337
109 3300031903 Ga0307407_10080708 Ga0307407_100807082 337
110 3300031995 Ga0307409_100178704 Ga0307409_1001787042 337
111 3300032004 Ga0307414_10220736 Ga0307414_102207362 337
112 3300032005 Ga0307411_10039693 Ga0307411_100396932 337
113 3300005337 Ga0070682_100012301 Ga0070682_1000123012 338
114 3300032004 Ga0307414_10002438 Ga0307414_100024382 338
115 3300050491 nmdc:mga00v17_105680_c1 nmdc:mga00v17_105680_c1_34_1071 338
116 3300005330 Ga0070690_100008784 Ga0070690_1000087844 339
117 3300005333 Ga0070677_10004394 Ga0070677_100043943 339
118 3300005337 Ga0070682_100046343 Ga0070682_1000463432 339
119 3300005340 Ga0070689_100070129 Ga0070689_1000701292 339
120 3300005356 Ga0070674_100041193 Ga0070674_1000411932 339
121 3300005440 Ga0070705_100011663 Ga0070705_1000116632 339
122 3300005456 Ga0070678_100140535 Ga0070678_1001405352 339
123 3300005543 Ga0070672_100038335 Ga0070672_1000383352 339
124 3300005544 Ga0070686_100010420 Ga0070686_1000104203 339
125 3300005617 Ga0068859_100050940 Ga0068859_1000509403 339
126 3300005719 Ga0068861_100016454 Ga0068861_1000164544 339
127 3300005841 Ga0068863_100092280 Ga0068863_1000922802 339
128 3300005842 Ga0068858_100079466 Ga0068858_1000794662 339
129 3300006358 Ga0068871_100239613 Ga0068871_1002396132 339
130 3300006931 Ga0097620_100050942 Ga0097620_1000509423 339
131 3300025893 Ga0207682_10002967 Ga0207682_100029674 339
132 3300025907 Ga0207645_10070073 Ga0207645_100700732 339
133 3300025933 Ga0207706_10296278 Ga0207706_102962782 339
134 3300025936 Ga0207670_10237366 Ga0207670_102373662 339
135 3300025937 Ga0207669_10031732 Ga0207669_100317322 339
136 3300025940 Ga0207691_10002796 Ga0207691_1000279611 339
137 3300025986 Ga0207658_10319755 Ga0207658_103197552 339
138 3300026118 Ga0207675_100005554 Ga0207675_1000055549 339
139 3300026121 Ga0207683_10024907 Ga0207683_100249073 339
140 3300031507 Ga0307509_10022680 Ga0307509_100226805 339
141 3300031548 Ga0307408_100077710 Ga0307408_1000777102 339
142 3300031824 Ga0307413_10036912 Ga0307413_100369122 339
143 3300031852 Ga0307410_10002380 Ga0307410_100023802 339
144 3300031901 Ga0307406_10055727 Ga0307406_100557272 339
145 3300031903 Ga0307407_10011202 Ga0307407_100112022 339
146 3300031911 Ga0307412_10105263 Ga0307412_101052632 339
147 3300031995 Ga0307409_100003665 Ga0307409_1000036656 339
148 3300032002 Ga0307416_100054417 Ga0307416_1000544173 339
149 3300032126 Ga0307415_100039304 Ga0307415_1000393042 339
150 3300041494 Ga0451837_0452642 Ga0451837_0452642_1039_2070 339
151 3300049574 Ga0501038_0223161 Ga0501038_0223161_363_1403 339
152 3300005354 Ga0070675_100104001 Ga0070675_1001040012 340
153 3300005437 Ga0070710_10142074 Ga0070710_101420742 340
154 3300005459 Ga0068867_100160408 Ga0068867_1001604082 340
155 3300005844 Ga0068862_100045022 Ga0068862_1000450223 340
156 3300005937 Ga0081455_10006925 Ga0081455_100069257 340
157 3300006358 Ga0068871_100337781 Ga0068871_1003377812 340
158 3300014326 Ga0157380_10036404 Ga0157380_100364042 340
159 3300025898 Ga0207692_10119277 Ga0207692_101192772 340
160 3300026075 Ga0207708_10005774 Ga0207708_100057742 340
161 3300035118 Ga0373954_0061934 Ga0373954_0061934_335_1378 340
162 3300048917 Ga0496114_0083733 Ga0496114_0083733_315_1349 340
163 3300049575 Ga0501039_0090415 Ga0501039_0090415_747_1841 340
164 3300049584 Ga0501068_0001490 Ga0501068_0001490_10500_11594 340
165 3300049586 Ga0501070_0035801 Ga0501070_0035801_395_1489 340
166 3300049587 Ga0501071_0012334 Ga0501071_0012334_4228_5322 340
167 3300049590 Ga0501074_0004546 Ga0501074_0004546_6763_7857 340
168 3300049591 Ga0501075_0044553 Ga0501075_0044553_2157_3251 340
169 3300049592 Ga0501076_0012431 Ga0501076_0012431_4483_5577 340
170 3300049593 Ga0501077_0040820 Ga0501077_0040820_1027_2121 340
171 3300049741 Ga0501079_0106042 Ga0501079_0106042_548_1642 340
172 3300049742 Ga0501080_0032790 Ga0501080_0032790_895_1989 340
173 3300049744 Ga0501083_0029092 Ga0501083_0029092_1366_2460 340
174 3300005441 Ga0070700_100230533 Ga0070700_1002305332 341
175 3300005719 Ga0068861_100010485 Ga0068861_1000104851 341
176 3300005840 Ga0068870_10019931 Ga0068870_100199312 341
177 3300006237 Ga0097621_100309747 Ga0097621_1003097471 341
178 3300009094 Ga0111539_10175222 Ga0111539_101752222 341
179 3300014325 Ga0163163_10049353 Ga0163163_100493532 341
180 3300025908 Ga0207643_10060051 Ga0207643_100600512 341
181 3300025936 Ga0207670_10251266 Ga0207670_102512662 341
182 3300026067 Ga0207678_10202900 Ga0207678_102029001 341
183 3300026075 Ga0207708_10282106 Ga0207708_102821061 341
184 3300026116 Ga0207674_10181947 Ga0207674_101819472 341
185 3300026118 Ga0207675_100017826 Ga0207675_1000178262 341
186 3300027907 Ga0207428_10259918 Ga0207428_102599182 341
187 3300041486 Ga0451807_1413778 Ga0451807_1413778_1101_2138 341
188 3300050511 nmdc:mga08y16_62681_c1 nmdc:mga08y16_62681_c1_2146_3231 341
189 3300003322 rootL2_10052819 rootL2_100528192 342
190 3300005466 Ga0070685_10127024 Ga0070685_101270242 342
191 3300005844 Ga0068862_100202899 Ga0068862_1002028992 342
192 3300006358 Ga0068871_100237685 Ga0068871_1002376852 342
193 3300041512 Ga0451853_0292669 Ga0451853_0292669_716_1753 342
194 3300046519 Ga0495632_0069949 Ga0495632_0069949_407_1441 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

97

364

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9102 24 335
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9052 34 342
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9049 24 335
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9022 34 342
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8896 24 335
ID Description Score Start End Superfamily
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9049 24 335 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9022 34 342 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8992 34 342 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8817 24 335 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8164 52 339 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A4Q6GV13-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9881 82 342 GO:0016787
AF-A0A839WWH7-F1-model_v4 Gluconolactonase (EC 3.1.1.17) 0.9866 34 341 GO:0016787
GO:0046872
AF-A0A4V2BIK5-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9866 162 342 GO:0016787
AF-A0A1T5K8W0-F1-model_v4 Gluconolactonase 0.9847 35 341 GO:0016787
GO:0046872
AF-A0A069J0L6-F1-model_v4 Gluconolactonase 0.982 36 339 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map