F298844

General Info

Members Datasets Scaffolds Average Seq Length
194 91 194 313

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100014749|Ga0307408_1000147492
Length 366
Sequence MRPVAADCVAASTFGRPASACVCFGYETAFPIDRWTNGGDERPSSNGHSSFSERRAYSGAMKIGMVGAGAIGGWVAARLAAAGEHVSILARGETAEALADGLHLVEGGDTVRAHPTIATVAGELGPQDLLVLAVKAPALAAAARAAQAMIGPDTAILPMLNGVPWWFSDPPLRSVDADGAIAAALPAGQVVGCVIHASCRREGPNRVVVAKADKLILGDPEGGAGQRVDRLCGLFERAGIHCQASTQIRRDIWYKLWGNATLNPLSALTLATADRLHAELRPIQLAGMAELAAVGAAIGCPIAESGEDRMAVTARLGPFKTSMLQDVEAGRPIELEALLCRAGVAVPTLETIYAMTRLMAESRGLL

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
84 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
85 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.06
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004848 3300001989 Bacteria 5126
2 JGI24744J21845_10006357 3300002077 Bacteria 2453
3 Ga0070658_10000264 3300005327 Bacteria 46199
4 Ga0070658_10002220 3300005327 Bacteria 16299
5 Ga0070658_10084656 3300005327 Bacteria 2607
6 Ga0070658_10145203 3300005327 Bacteria 1983
7 Ga0070658_10210399 3300005327 Bacteria 1643
8 Ga0070658_10283362 3300005327 Bacteria 1411
9 Ga0070676_10015573 3300005328 Bacteria 4196
10 Ga0070683_100203672 3300005329 Bacteria 1879
11 Ga0070680_100000406 3300005336 Bacteria 29408
12 Ga0070680_100079632 3300005336 Bacteria 2701
13 Ga0068868_100042286 3300005338 Bacteria 3555
14 Ga0068868_100098631 3300005338 Bacteria 2362
15 Ga0070660_100000091 3300005339 Bacteria 54397
16 Ga0070660_100004304 3300005339 Bacteria 9834
17 Ga0070660_100037094 3300005339 Bacteria 3694
18 Ga0070660_100069653 3300005339 Bacteria 2743
19 Ga0070660_100076200 3300005339 Bacteria 2627
20 Ga0070660_100085380 3300005339 Bacteria 2482
21 Ga0070660_100113012 3300005339 Bacteria 2162
22 Ga0070661_100329645 3300005344 Bacteria 1194
23 Ga0070692_10000681 3300005345 Bacteria 10878
24 Ga0070692_10004311 3300005345 Bacteria 5916
25 Ga0070692_10008334 3300005345 Bacteria 4619
26 Ga0070675_100042624 3300005354 Bacteria 3708
27 Ga0070675_100086779 3300005354 Bacteria 2616
28 Ga0070671_100024471 3300005355 Bacteria 4943
29 Ga0070674_100053326 3300005356 Bacteria 2791
30 Ga0070673_100012501 3300005364 Bacteria 5830
31 Ga0070659_100025316 3300005366 Bacteria 4556
32 Ga0070659_100052834 3300005366 Bacteria 3197
33 Ga0070659_100075017 3300005366 Bacteria 2695
34 Ga0070659_100374729 3300005366 Bacteria 1198
35 Ga0070667_100011471 3300005367 Bacteria 7328
36 Ga0070667_100132628 3300005367 Bacteria 2175
37 Ga0070663_100000991 3300005455 Bacteria 15463
38 Ga0070663_100051577 3300005455 Bacteria 2931
39 Ga0070678_100017948 3300005456 Bacteria 4573
40 Ga0070662_100017439 3300005457 Bacteria 4842
41 Ga0070662_100032684 3300005457 Bacteria 3657
42 Ga0070662_100114507 3300005457 Bacteria 2059
43 Ga0070662_100217898 3300005457 Bacteria 1521
44 Ga0070662_100399819 3300005457 Bacteria 1133
45 Ga0070681_10218648 3300005458 Bacteria 1821
46 Ga0070679_100055837 3300005530 Bacteria 3934
47 Ga0070679_100063951 3300005530 Bacteria 3667
48 Ga0068853_100090137 3300005539 Bacteria 2695
49 Ga0070665_100575558 3300005548 Bacteria 1139
50 Ga0068855_100000129 3300005563 Bacteria 96519
51 Ga0068855_100059044 3300005563 Bacteria 4489
52 Ga0070664_100037120 3300005564 Bacteria 4095
53 Ga0068854_100039619 3300005578 Bacteria 3321
54 Ga0068854_100054005 3300005578 Bacteria 2888
55 Ga0068858_100189963 3300005842 Bacteria 1941
56 Ga0081539_10031927 3300005985 Bacteria 3235
57 Ga0105248_10038710 3300009177 Bacteria 5338
58 Ga0105248_10082594 3300009177 Bacteria 3613
59 Ga0105248_10197936 3300009177 Bacteria 2264
60 Ga0157373_10318666 3300013100 Bacteria 1106
61 Ga0157371_10005808 3300013102 Bacteria 10326
62 Ga0157370_10062343 3300013104 Bacteria 3536
63 Ga0157374_10021823 3300013296 Bacteria 5704
64 Ga0157378_10376216 3300013297 Bacteria 1394
65 Ga0163162_10053942 3300013306 Bacteria 4042
66 Ga0157375_10033877 3300013308 Bacteria 4858
67 Ga0157377_10067067 3300014745 Bacteria 2065
68 Ga0157379_10071361 3300014968 Bacteria 3107
69 Ga0157376_10378045 3300014969 Bacteria 1364
70 Ga0207697_10003538 3300025315 Bacteria 7702
71 Ga0207647_10004040 3300025904 Bacteria 10933
72 Ga0207647_10042884 3300025904 Bacteria 2835
73 Ga0207643_10055903 3300025908 Bacteria 2245
74 Ga0207705_10000091 3300025909 Bacteria 110768
75 Ga0207705_10005213 3300025909 Bacteria 9747
76 Ga0207705_10029365 3300025909 Bacteria 3919
77 Ga0207705_10077902 3300025909 Bacteria 2412
78 Ga0207705_10106796 3300025909 Bacteria 2065
79 Ga0207705_10246722 3300025909 Bacteria 1361
80 Ga0207693_10210849 3300025915 Bacteria 1527
81 Ga0207660_10000515 3300025917 Bacteria 25797
82 Ga0207657_10000092 3300025919 Bacteria 85665
83 Ga0207657_10000252 3300025919 Bacteria 57036
84 Ga0207657_10046401 3300025919 Bacteria 3805
85 Ga0207652_10052462 3300025921 Bacteria 3500
86 Ga0207652_10063418 3300025921 Bacteria 3196
87 Ga0207659_10053725 3300025926 Bacteria 2874
88 Ga0207659_10127660 3300025926 Bacteria 1958
89 Ga0207700_10441910 3300025928 Bacteria 1145
90 Ga0207644_10006073 3300025931 Bacteria 7876
91 Ga0207690_10016770 3300025932 Bacteria 4464
92 Ga0207690_10034725 3300025932 Bacteria 3251
93 Ga0207690_10123942 3300025932 Bacteria 1881
94 Ga0207706_10056736 3300025933 Bacteria 3452
95 Ga0207706_10057806 3300025933 Bacteria 3416
96 Ga0207706_10067699 3300025933 Bacteria 3142
97 Ga0207669_10061747 3300025937 Bacteria 2305
98 Ga0207669_10094361 3300025937 Bacteria 1957
99 Ga0207691_10399979 3300025940 Bacteria 1171
100 Ga0207711_10019512 3300025941 Bacteria 5644
101 Ga0207711_10199147 3300025941 Bacteria 1827
102 Ga0207661_10553415 3300025944 Bacteria 1054
103 Ga0207679_10006275 3300025945 Bacteria 7501
104 Ga0207667_10000303 3300025949 Bacteria 68209
105 Ga0207667_10491448 3300025949 Bacteria 1245
106 Ga0207651_10023505 3300025960 Bacteria 3793
107 Ga0207651_10367739 3300025960 Bacteria 1216
108 Ga0207658_10058227 3300025986 Bacteria 2874
109 Ga0207677_10288620 3300026023 Bacteria 1350
110 Ga0207678_10010854 3300026067 Bacteria 8006
111 Ga0207678_10023015 3300026067 Bacteria 5452
112 Ga0207678_10063313 3300026067 Bacteria 3178
113 Ga0207678_10188056 3300026067 Bacteria 1764
114 Ga0207648_10024094 3300026089 Bacteria 5438
115 Ga0207683_10031613 3300026121 Bacteria 4594
116 Ga0207683_10086465 3300026121 Bacteria 2787
117 Ga0268264_10017800 3300028381 Bacteria 5817
118 Ga0307408_100014749 3300031548 Bacteria 5195
119 Ga0307405_10025546 3300031731 Bacteria 3393
120 Ga0307413_10041032 3300031824 Bacteria 2706
121 Ga0307413_10238781 3300031824 Bacteria 1340
122 Ga0307410_10003939 3300031852 Bacteria 7558
123 Ga0307410_10060046 3300031852 Bacteria 2597
124 Ga0307407_10047111 3300031903 Bacteria 2444
125 Ga0307412_10023665 3300031911 Bacteria 3782
126 Ga0307409_100071577 3300031995 Bacteria 2757
127 Ga0307416_100002575 3300032002 Bacteria 10470
128 Ga0307416_100290483 3300032002 Bacteria 1618
129 Ga0307414_10010604 3300032004 Bacteria 5358
130 Ga0307414_10036077 3300032004 Bacteria 3297
131 Ga0307414_10201140 3300032004 Bacteria 1620
132 Ga0307411_10000751 3300032005 Bacteria 11970
133 Ga0307411_10006853 3300032005 Bacteria 5739
134 Ga0307415_100005762 3300032126 Bacteria 6609
135 Ga0307415_100477018 3300032126 Bacteria 1085
136 Ga0395899_0000132 3300037312 Bacteria 115455
137 Ga0395899_0001019 3300037312 Bacteria 25588
138 Ga0395899_0017263 3300037312 Bacteria 5500
139 Ga0395899_0018720 3300037312 Bacteria 5262
140 Ga0395899_0024533 3300037312 Bacteria 4558
141 Ga0395899_0071805 3300037312 Bacteria 2533
142 Ga0395899_0084437 3300037312 Bacteria 2308
143 Ga0395900_0000075 3300037418 Bacteria 183525
144 Ga0395900_0000477 3300037418 Bacteria 56791
145 Ga0395900_0016780 3300037418 Bacteria 7469
146 Ga0395900_0048366 3300037418 Bacteria 4381
147 Ga0395900_0048536 3300037418 Bacteria 4373
148 Ga0395900_0069147 3300037418 Bacteria 3629
149 Ga0395900_0113451 3300037418 Bacteria 2781
150 Ga0395900_0147312 3300037418 Bacteria 2407
151 Ga0395900_0244232 3300037418 Bacteria 1800
152 Ga0395898_0000055 3300037466 Bacteria 278557
153 Ga0395898_0020318 3300037466 Bacteria 6745
154 Ga0395898_0025357 3300037466 Bacteria 5975
155 Ga0395898_0044369 3300037466 Bacteria 4377
156 Ga0395898_0050240 3300037466 Bacteria 4082
157 Ga0395898_0102522 3300037466 Bacteria 2747
158 Ga0395905_0000067 3300037471 Bacteria 181887
159 Ga0395905_0001128 3300037471 Bacteria 33451
160 Ga0395905_0020258 3300037471 Bacteria 6301
161 Ga0395905_0027427 3300037471 Bacteria 5371
162 Ga0395905_0032573 3300037471 Bacteria 4901
163 Ga0395905_0035091 3300037471 Bacteria 4708
164 Ga0395905_0039599 3300037471 Bacteria 4422
165 Ga0395905_0051667 3300037471 Bacteria 3850
166 Ga0395905_0081038 3300037471 Bacteria 3042
167 Ga0395905_0090269 3300037471 Bacteria 2872
168 Ga0395905_0095405 3300037471 Bacteria 2791
169 Ga0395905_0116451 3300037471 Bacteria 2512
170 Ga0395905_0151536 3300037471 Bacteria 2181
171 Ga0395905_0340258 3300037471 Bacteria 1391
172 Ga0395905_0435355 3300037471 Bacteria 1208
173 Ga0395901_0000208 3300038443 Bacteria 73874
174 Ga0395901_0000648 3300038443 Bacteria 40227
175 Ga0395901_0007319 3300038443 Bacteria 11142
176 Ga0395901_0016789 3300038443 Bacteria 7460
177 Ga0395901_0018576 3300038443 Bacteria 7100
178 Ga0395901_0024510 3300038443 Bacteria 6193
179 Ga0395901_0026360 3300038443 Bacteria 5967
180 Ga0395901_0039298 3300038443 Bacteria 4896
181 Ga0395901_0235486 3300038443 Bacteria 1911
182 Ga0395901_0314251 3300038443 Bacteria 1622
183 Ga0395901_0427407 3300038443 Bacteria 1357
184 Ga0395901_0808538 3300038443 Unclassified 926
185 Ga0439448_0026303 3300042005 Bacteria 1829
186 Ga0439464_0008509 3300042439 Bacteria 2689
187 Ga0495598_0001164 3300046537 Bacteria 5078
188 Ga0495621_0000179 3300046539 Bacteria 14449
189 Ga0495633_0169605 3300046558 Unclassified 1006
190 Ga0495669_0027001 3300046684 Bacteria 2510
191 Ga0496100_0202103 3300048903 Bacteria 1449
192 Ga0496102_0407884 3300048905 Bacteria 1277
193 Ga0496108_0018850 3300048911 Bacteria 5658
194 Ga0496112_0095815 3300048915 Bacteria 2938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0071805 Ga0395899_0071805_1726_2511 257
2 3300038443 Ga0395901_0808538 Ga0395901_0808538_28_861 268
3 3300032005 Ga0307411_10006853 Ga0307411_100068532 276
4 3300005548 Ga0070665_100575558 Ga0070665_1005755582 281
5 3300025940 Ga0207691_10399979 Ga0207691_103999792 281
6 3300032004 Ga0307414_10201140 Ga0307414_102011402 295
7 3300031548 Ga0307408_100014749 Ga0307408_1000147492 296
8 3300031731 Ga0307405_10025546 Ga0307405_100255462 296
9 3300031824 Ga0307413_10041032 Ga0307413_100410322 296
10 3300031852 Ga0307410_10003939 Ga0307410_100039395 296
11 3300031903 Ga0307407_10047111 Ga0307407_100471113 296
12 3300031911 Ga0307412_10023665 Ga0307412_100236652 296
13 3300032002 Ga0307416_100002575 Ga0307416_1000025758 296
14 3300032004 Ga0307414_10036077 Ga0307414_100360772 296
15 3300032126 Ga0307415_100005762 Ga0307415_1000057623 296
16 3300014745 Ga0157377_10067067 Ga0157377_100670672 301
17 3300009177 Ga0105248_10082594 Ga0105248_100825943 303
18 3300046684 Ga0495669_0027001 Ga0495669_0027001_838_1791 303
19 3300005327 Ga0070658_10283362 Ga0070658_102833621 304
20 3300025909 Ga0207705_10077902 Ga0207705_100779022 304
21 3300005327 Ga0070658_10000264 Ga0070658_1000026431 305
22 3300005327 Ga0070658_10002220 Ga0070658_1000222014 305
23 3300005327 Ga0070658_10084656 Ga0070658_100846562 305
24 3300005327 Ga0070658_10145203 Ga0070658_101452032 305
25 3300005327 Ga0070658_10210399 Ga0070658_102103991 305
26 3300005336 Ga0070680_100000406 Ga0070680_1000004069 305
27 3300005336 Ga0070680_100079632 Ga0070680_1000796322 305
28 3300005339 Ga0070660_100000091 Ga0070660_10000009116 305
29 3300005339 Ga0070660_100004304 Ga0070660_10000430411 305
30 3300005339 Ga0070660_100069653 Ga0070660_1000696534 305
31 3300005345 Ga0070692_10000681 Ga0070692_100006815 305
32 3300005345 Ga0070692_10004311 Ga0070692_100043113 305
33 3300005345 Ga0070692_10008334 Ga0070692_100083341 305
34 3300005366 Ga0070659_100052834 Ga0070659_1000528342 305
35 3300005366 Ga0070659_100374729 Ga0070659_1003747291 305
36 3300005455 Ga0070663_100000991 Ga0070663_10000099110 305
37 3300005457 Ga0070662_100399819 Ga0070662_1003998191 305
38 3300005458 Ga0070681_10218648 Ga0070681_102186482 305
39 3300005530 Ga0070679_100055837 Ga0070679_1000558372 305
40 3300005530 Ga0070679_100063951 Ga0070679_1000639513 305
41 3300005563 Ga0068855_100000129 Ga0068855_10000012962 305
42 3300005563 Ga0068855_100059044 Ga0068855_1000590445 305
43 3300013102 Ga0157371_10005808 Ga0157371_100058084 305
44 3300013104 Ga0157370_10062343 Ga0157370_100623432 305
45 3300025904 Ga0207647_10004040 Ga0207647_1000404012 305
46 3300025909 Ga0207705_10000091 Ga0207705_10000091102 305
47 3300025909 Ga0207705_10005213 Ga0207705_100052135 305
48 3300025909 Ga0207705_10029365 Ga0207705_100293653 305
49 3300025909 Ga0207705_10106796 Ga0207705_101067962 305
50 3300025909 Ga0207705_10246722 Ga0207705_102467222 305
51 3300025917 Ga0207660_10000515 Ga0207660_1000051513 305
52 3300025919 Ga0207657_10000092 Ga0207657_1000009277 305
53 3300025919 Ga0207657_10000252 Ga0207657_1000025245 305
54 3300025919 Ga0207657_10046401 Ga0207657_100464012 305
55 3300025921 Ga0207652_10052462 Ga0207652_100524623 305
56 3300025921 Ga0207652_10063418 Ga0207652_100634183 305
57 3300025932 Ga0207690_10034725 Ga0207690_100347252 305
58 3300025949 Ga0207667_10000303 Ga0207667_1000030335 305
59 3300026067 Ga0207678_10010854 Ga0207678_1001085410 305
60 3300026067 Ga0207678_10063313 Ga0207678_100633133 305
61 3300037312 Ga0395899_0000132 Ga0395899_0000132_21969_22919 305
62 3300037312 Ga0395899_0024533 Ga0395899_0024533_652_1623 305
63 3300037418 Ga0395900_0000477 Ga0395900_0000477_48626_49576 305
64 3300037418 Ga0395900_0048366 Ga0395900_0048366_1221_2192 305
65 3300037418 Ga0395900_0113451 Ga0395900_0113451_594_1544 305
66 3300037418 Ga0395900_0244232 Ga0395900_0244232_697_1647 305
67 3300037466 Ga0395898_0044369 Ga0395898_0044369_331_1302 305
68 3300037466 Ga0395898_0050240 Ga0395898_0050240_3101_4051 305
69 3300037466 Ga0395898_0102522 Ga0395898_0102522_41_991 305
70 3300037471 Ga0395905_0081038 Ga0395905_0081038_1320_2270 305
71 3300037471 Ga0395905_0090269 Ga0395905_0090269_889_1839 305
72 3300038443 Ga0395901_0000208 Ga0395901_0000208_25765_26715 305
73 3300038443 Ga0395901_0235486 Ga0395901_0235486_534_1484 305
74 3300038443 Ga0395901_0314251 Ga0395901_0314251_291_1244 305
75 3300005339 Ga0070660_100076200 Ga0070660_1000762002 306
76 3300005366 Ga0070659_100025316 Ga0070659_1000253163 306
77 3300005367 Ga0070667_100011471 Ga0070667_1000114715 306
78 3300005457 Ga0070662_100017439 Ga0070662_1000174392 306
79 3300014968 Ga0157379_10071361 Ga0157379_100713612 306
80 3300025904 Ga0207647_10042884 Ga0207647_100428843 306
81 3300025933 Ga0207706_10057806 Ga0207706_100578062 306
82 3300025941 Ga0207711_10019512 Ga0207711_100195124 306
83 3300025986 Ga0207658_10058227 Ga0207658_100582272 306
84 3300028381 Ga0268264_10017800 Ga0268264_100178001 306
85 3300031824 Ga0307413_10238781 Ga0307413_102387812 306
86 3300037312 Ga0395899_0018720 Ga0395899_0018720_3501_4421 306
87 3300037312 Ga0395899_0084437 Ga0395899_0084437_1322_2278 306
88 3300037418 Ga0395900_0048536 Ga0395900_0048536_1816_2736 306
89 3300037418 Ga0395900_0069147 Ga0395900_0069147_1481_2404 306
90 3300037418 Ga0395900_0147312 Ga0395900_0147312_343_1263 306
91 3300037466 Ga0395898_0025357 Ga0395898_0025357_1688_2608 306
92 3300037471 Ga0395905_0001128 Ga0395905_0001128_24575_25495 306
93 3300037471 Ga0395905_0020258 Ga0395905_0020258_3712_4632 306
94 3300037471 Ga0395905_0035091 Ga0395905_0035091_735_1658 306
95 3300037471 Ga0395905_0051667 Ga0395905_0051667_1416_2336 306
96 3300037471 Ga0395905_0151536 Ga0395905_0151536_225_1148 306
97 3300037471 Ga0395905_0340258 Ga0395905_0340258_104_1024 306
98 3300038443 Ga0395901_0016789 Ga0395901_0016789_580_1500 306
99 3300038443 Ga0395901_0018576 Ga0395901_0018576_5339_6259 306
100 3300038443 Ga0395901_0024510 Ga0395901_0024510_5171_6091 306
101 3300038443 Ga0395901_0026360 Ga0395901_0026360_2809_3729 306
102 3300038443 Ga0395901_0427407 Ga0395901_0427407_259_1179 306
103 3300042439 Ga0439464_0008509 Ga0439464_0008509_706_1629 306
104 3300048911 Ga0496108_0018850 Ga0496108_0018850_3520_4473 306
105 3300001989 JGI24739J22299_10004848 JGI24739J22299_100048484 307
106 3300002077 JGI24744J21845_10006357 JGI24744J21845_100063572 307
107 3300005328 Ga0070676_10015573 Ga0070676_100155733 307
108 3300005329 Ga0070683_100203672 Ga0070683_1002036722 307
109 3300005338 Ga0068868_100042286 Ga0068868_1000422864 307
110 3300005338 Ga0068868_100098631 Ga0068868_1000986312 307
111 3300005339 Ga0070660_100037094 Ga0070660_1000370942 307
112 3300005339 Ga0070660_100085380 Ga0070660_1000853803 307
113 3300005339 Ga0070660_100113012 Ga0070660_1001130122 307
114 3300005344 Ga0070661_100329645 Ga0070661_1003296452 307
115 3300005354 Ga0070675_100042624 Ga0070675_1000426241 307
116 3300005354 Ga0070675_100086779 Ga0070675_1000867792 307
117 3300005355 Ga0070671_100024471 Ga0070671_1000244712 307
118 3300005356 Ga0070674_100053326 Ga0070674_1000533263 307
119 3300005364 Ga0070673_100012501 Ga0070673_1000125015 307
120 3300005366 Ga0070659_100075017 Ga0070659_1000750172 307
121 3300005367 Ga0070667_100132628 Ga0070667_1001326282 307
122 3300005455 Ga0070663_100051577 Ga0070663_1000515773 307
123 3300005456 Ga0070678_100017948 Ga0070678_1000179483 307
124 3300005457 Ga0070662_100032684 Ga0070662_1000326843 307
125 3300005457 Ga0070662_100114507 Ga0070662_1001145072 307
126 3300005457 Ga0070662_100217898 Ga0070662_1002178982 307
127 3300005539 Ga0068853_100090137 Ga0068853_1000901372 307
128 3300005564 Ga0070664_100037120 Ga0070664_1000371203 307
129 3300005578 Ga0068854_100039619 Ga0068854_1000396192 307
130 3300005578 Ga0068854_100054005 Ga0068854_1000540053 307
131 3300005842 Ga0068858_100189963 Ga0068858_1001899632 307
132 3300005985 Ga0081539_10031927 Ga0081539_100319274 307
133 3300009177 Ga0105248_10038710 Ga0105248_100387103 307
134 3300009177 Ga0105248_10197936 Ga0105248_101979362 307
135 3300013100 Ga0157373_10318666 Ga0157373_103186662 307
136 3300013296 Ga0157374_10021823 Ga0157374_100218236 307
137 3300013297 Ga0157378_10376216 Ga0157378_103762162 307
138 3300013306 Ga0163162_10053942 Ga0163162_100539422 307
139 3300013308 Ga0157375_10033877 Ga0157375_100338772 307
140 3300014969 Ga0157376_10378045 Ga0157376_103780452 307
141 3300025315 Ga0207697_10003538 Ga0207697_100035386 307
142 3300025908 Ga0207643_10055903 Ga0207643_100559032 307
143 3300025915 Ga0207693_10210849 Ga0207693_102108491 307
144 3300025926 Ga0207659_10053725 Ga0207659_100537252 307
145 3300025926 Ga0207659_10127660 Ga0207659_101276602 307
146 3300025928 Ga0207700_10441910 Ga0207700_104419101 307
147 3300025931 Ga0207644_10006073 Ga0207644_100060733 307
148 3300025932 Ga0207690_10016770 Ga0207690_100167703 307
149 3300025932 Ga0207690_10123942 Ga0207690_101239422 307
150 3300025933 Ga0207706_10056736 Ga0207706_100567362 307
151 3300025933 Ga0207706_10067699 Ga0207706_100676992 307
152 3300025937 Ga0207669_10061747 Ga0207669_100617472 307
153 3300025937 Ga0207669_10094361 Ga0207669_100943612 307
154 3300025941 Ga0207711_10199147 Ga0207711_101991472 307
155 3300025944 Ga0207661_10553415 Ga0207661_105534151 307
156 3300025945 Ga0207679_10006275 Ga0207679_100062755 307
157 3300025949 Ga0207667_10491448 Ga0207667_104914482 307
158 3300025960 Ga0207651_10023505 Ga0207651_100235053 307
159 3300025960 Ga0207651_10367739 Ga0207651_103677392 307
160 3300026023 Ga0207677_10288620 Ga0207677_102886202 307
161 3300026067 Ga0207678_10023015 Ga0207678_100230156 307
162 3300026067 Ga0207678_10188056 Ga0207678_101880562 307
163 3300026089 Ga0207648_10024094 Ga0207648_100240943 307
164 3300026121 Ga0207683_10031613 Ga0207683_100316133 307
165 3300026121 Ga0207683_10086465 Ga0207683_100864651 307
166 3300031852 Ga0307410_10060046 Ga0307410_100600462 307
167 3300031995 Ga0307409_100071577 Ga0307409_1000715772 307
168 3300032002 Ga0307416_100290483 Ga0307416_1002904832 307
169 3300032004 Ga0307414_10010604 Ga0307414_100106047 307
170 3300032005 Ga0307411_10000751 Ga0307411_1000075112 307
171 3300032126 Ga0307415_100477018 Ga0307415_1004770182 307
172 3300037312 Ga0395899_0001019 Ga0395899_0001019_24082_25011 307
173 3300037312 Ga0395899_0017263 Ga0395899_0017263_1785_2708 307
174 3300037418 Ga0395900_0000075 Ga0395900_0000075_4695_5624 307
175 3300037418 Ga0395900_0016780 Ga0395900_0016780_2750_3673 307
176 3300037466 Ga0395898_0000055 Ga0395898_0000055_181214_182143 307
177 3300037466 Ga0395898_0020318 Ga0395898_0020318_2753_3676 307
178 3300037471 Ga0395905_0000067 Ga0395905_0000067_96415_97344 307
179 3300037471 Ga0395905_0027427 Ga0395905_0027427_3760_4683 307
180 3300037471 Ga0395905_0032573 Ga0395905_0032573_1021_1944 307
181 3300037471 Ga0395905_0039599 Ga0395905_0039599_12_935 307
182 3300037471 Ga0395905_0095405 Ga0395905_0095405_473_1408 307
183 3300037471 Ga0395905_0116451 Ga0395905_0116451_961_1899 307
184 3300037471 Ga0395905_0435355 Ga0395905_0435355_127_1050 307
185 3300038443 Ga0395901_0000648 Ga0395901_0000648_18344_19273 307
186 3300038443 Ga0395901_0007319 Ga0395901_0007319_10074_11009 307
187 3300038443 Ga0395901_0039298 Ga0395901_0039298_2057_2980 307
188 3300042005 Ga0439448_0026303 Ga0439448_0026303_444_1367 307
189 3300046537 Ga0495598_0001164 Ga0495598_0001164_2774_3697 307
190 3300046539 Ga0495621_0000179 Ga0495621_0000179_9740_10663 307
191 3300046558 Ga0495633_0169605 Ga0495633_0169605_73_996 307
192 3300048903 Ga0496100_0202103 Ga0496100_0202103_13_936 307
193 3300048905 Ga0496102_0407884 Ga0496102_0407884_214_1137 307
194 3300048915 Ga0496112_0095815 Ga0496112_0095815_1555_2478 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

63

222

0.95

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

247

360

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghy-assembly3.cif.gz_B crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.9345 3 307
6aio-assembly1.cif.gz_A crystal structure of p-nitrophenol 4-monooxygenase pnpa from pseudomonas putida dll-e4 0.9337 3 31
3ghy-assembly3.cif.gz_A crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.9305 2 307
3ghy-assembly3.cif.gz_B crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.9256 3 307
3ghy-assembly3.cif.gz_A crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.9246 2 307
ID Description Score Start End Superfamily
3ghyA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9752 180 307 1.10.1040.10
3ghyB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9707 180 307 1.10.1040.10
3ghyA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.96 180 307 1.10.1040.10
3ghyB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9557 180 307 1.10.1040.10
3i83B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9358 179 304 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A529ZAI0-F1-model_v4 Oxidoreductase 0.9781 180 307 GO:0005737
AF-A0A4R9WW30-F1-model_v4 Oxidoreductase 0.9746 180 303 GO:0005737
AF-A0A435EZ16-F1-model_v4 deleted 0.9742 193 306
AF-A0A352S273-F1-model_v4 Oxidoreductase 0.9716 195 304 GO:0005737
AF-A0A4Q5VUX6-F1-model_v4 deleted 0.9709 62 307

Feature Viewer

pLDDT pTM Quality
95.43 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map