F298186

General Info

Members Datasets Scaffolds Average Seq Length
194 119 193 71

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_101354783|Ga0070682_1013547831
Length 81
Sequence VWARSGRVSAVMGDEKFGKGDHVTWKSHGGTAEGTVEKKITEDTEAAGRTVRASKDDPQYLVKSEKSGGEAVHKPGALKKT

Samples

Sample ID Description Type Environment
1 2891562705 Microbispora tritici MT50 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
41 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
42 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
43 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
44 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 1.55
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 5.15
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 4.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10371707 3300005327 Bacteria 1226
2 Ga0070683_100346009 3300005329 Bacteria 1416
3 Ga0070683_100478146 3300005329 Bacteria 1190
4 Ga0070683_100717866 3300005329 Bacteria 957
5 Ga0070670_101432399 3300005331 Bacteria 634
6 Ga0068869_100919326 3300005334 Bacteria 758
7 Ga0070682_100025148 3300005337 Bacteria 3551
8 Ga0070682_101354783 3300005337 Bacteria 607
9 Ga0070660_100274812 3300005339 Bacteria 1378
10 Ga0070689_100561003 3300005340 Bacteria 985
11 Ga0070675_101186217 3300005354 Bacteria 703
12 Ga0070688_100447747 3300005365 Bacteria 965
13 Ga0070700_100345001 3300005441 Bacteria 1102
14 Ga0070662_100757777 3300005457 Bacteria 824
15 Ga0068867_102136323 3300005459 Bacteria 531
16 Ga0070685_10096400 3300005466 Bacteria 1799
17 Ga0070685_10876189 3300005466 Bacteria 667
18 Ga0070693_100576026 3300005547 Bacteria 809
19 Ga0070665_100133377 3300005548 Bacteria 2485
20 Ga0070665_100183172 3300005548 Bacteria 2095
21 Ga0070665_100469500 3300005548 Bacteria 1269
22 Ga0068857_101088215 3300005577 Bacteria 771
23 Ga0068857_101301639 3300005577 Bacteria 705
24 Ga0068854_100099062 3300005578 Bacteria 2182
25 Ga0068859_100308514 3300005617 Bacteria 1676
26 Ga0068866_10618296 3300005718 Bacteria 734
27 Ga0068861_101951215 3300005719 Bacteria 585
28 Ga0068851_10148386 3300005834 Bacteria 1280
29 Ga0068870_10530161 3300005840 Bacteria 790
30 Ga0068870_10575797 3300005840 Bacteria 762
31 Ga0068858_101258770 3300005842 Bacteria 728
32 Ga0075428_101626081 3300006844 Bacteria 675
33 Ga0075434_100952939 3300006871 Bacteria 873
34 Ga0068865_100242875 3300006881 Bacteria 1418
35 Ga0068865_101124464 3300006881 Bacteria 693
36 Ga0068865_101414800 3300006881 Bacteria 621
37 Ga0097620_100308539 3300006931 Bacteria 1676
38 Ga0111539_10228867 3300009094 Bacteria 2165
39 Ga0111539_11726985 3300009094 Bacteria 726
40 Ga0105245_10426456 3300009098 Bacteria 1330
41 Ga0105247_10372642 3300009101 Bacteria 1010
42 Ga0105243_10357990 3300009148 Bacteria 1342
43 Ga0105243_11378707 3300009148 Bacteria 725
44 Ga0105243_12487753 3300009148 Bacteria 557
45 Ga0105241_10825971 3300009174 Bacteria 855
46 Ga0105242_10659306 3300009176 Bacteria 1019
47 Ga0105248_13002243 3300009177 Bacteria 537
48 Ga0105237_10525349 3300009545 Bacteria 1190
49 Ga0105249_10823968 3300009553 Bacteria 993
50 Ga0105239_12527022 3300010375 Bacteria 599
51 Ga0105246_10222727 3300011119 Bacteria 1480
52 Ga0105246_11953239 3300011119 Bacteria 565
53 Ga0157318_1004840 3300012482 Bacteria 835
54 Ga0157319_1030520 3300012497 Bacteria 580
55 Ga0157342_1040011 3300012507 Bacteria 624
56 Ga0157327_1057667 3300012512 Bacteria 570
57 Ga0157338_1070787 3300012515 Bacteria 544
58 Ga0157369_11194146 3300013105 Bacteria 776
59 Ga0163162_11465620 3300013306 Bacteria 777
60 Ga0157372_12586700 3300013307 Bacteria 582
61 Ga0157375_10287548 3300013308 Bacteria 1807
62 Ga0157375_11147096 3300013308 Bacteria 911
63 Ga0163163_10335459 3300014325 Bacteria 1567
64 Ga0157380_11520223 3300014326 Bacteria 723
65 Ga0157377_10431842 3300014745 Bacteria 905
66 Ga0157377_11033009 3300014745 Bacteria 625
67 Ga0157376_12086752 3300014969 Bacteria 605
68 Ga0163161_10945187 3300017792 Bacteria 733
69 Ga0206356_10323499 3300020070 Bacteria 583
70 Ga0206353_10015334 3300020082 Bacteria 1017
71 Ga0206353_10546405 3300020082 Bacteria 1028
72 Ga0213874_10327332 3300021377 Bacteria 582
73 Ga0213875_10000745 3300021388 Bacteria 24615
74 Ga0207642_10217024 3300025899 Bacteria 1067
75 Ga0207688_10111646 3300025901 Bacteria 1587
76 Ga0207688_10289006 3300025901 Bacteria 1000
77 Ga0207643_10251512 3300025908 Bacteria 1089
78 Ga0207657_10244546 3300025919 Bacteria 1431
79 Ga0207659_10374354 3300025926 Bacteria 1186
80 Ga0207690_11093421 3300025932 Bacteria 664
81 Ga0207670_11405932 3300025936 Bacteria 592
82 Ga0207691_10218001 3300025940 Bacteria 1655
83 Ga0207689_10175116 3300025942 Bacteria 1769
84 Ga0207661_10387954 3300025944 Bacteria 1265
85 Ga0207661_10673288 3300025944 Bacteria 951
86 Ga0207712_10535307 3300025961 Bacteria 1006
87 Ga0207712_11165725 3300025961 Bacteria 687
88 Ga0207677_10552442 3300026023 Bacteria 1004
89 Ga0207678_10147034 3300026067 Bacteria 2011
90 Ga0207708_10031646 3300026075 Bacteria 4016
91 Ga0207676_10175537 3300026095 Bacteria 1871
92 Ga0207674_10894698 3300026116 Bacteria 856
93 Ga0207675_100277958 3300026118 Bacteria 1626
94 Ga0207683_10091141 3300026121 Bacteria 2715
95 Ga0207683_10392149 3300026121 Bacteria 1277
96 Ga0207698_10097238 3300026142 Bacteria 2429
97 Ga0268266_10298996 3300028379 Bacteria 1501
98 Ga0268264_11664559 3300028381 Bacteria 649
99 Ga0307413_11854583 3300031824 Unclassified 541
100 Ga0307406_11267568 3300031901 Bacteria 642
101 Ga0307407_10902799 3300031903 Bacteria 678
102 Ga0307407_11292184 3300031903 Bacteria 572
103 Ga0307409_100657072 3300031995 Bacteria 1043
104 Ga0307414_10214691 3300032004 Unclassified 1575
105 Ga0307414_11566444 3300032004 Bacteria 614
106 Ga0307415_100830462 3300032126 Bacteria 846
107 Ga0307415_101240023 3300032126 Bacteria 704
108 Ga0373952_0134587 3300035092 Bacteria 682
109 Ga0373931_0120009 3300035691 Bacteria 1502
110 Ga0436364_1223233 3300037853 Bacteria 42179
111 Ga0436365_1845293 3300039437 Bacteria 1235
112 Ga0436363_1096608 3300039450 Bacteria 887
113 Ga0436363_1223189 3300039450 Bacteria 772
114 Ga0436363_1253558 3300039450 Bacteria 582
115 Ga0451791_1936707 3300041451 Bacteria 516
116 Ga0451802_0890438 3300041460 Bacteria 649
117 Ga0451807_1090760 3300041486 Bacteria 571
118 Ga0451853_3330384 3300041512 Bacteria 686
119 Ga0466969_0095019 3300044656 Bacteria 1409
120 Ga0466969_0107152 3300044656 Bacteria 1311
121 Ga0466969_0613172 3300044656 Bacteria 500
122 Ga0466972_0212284 3300044658 Bacteria 906
123 Ga0466972_0356174 3300044658 Bacteria 684
124 Ga0466965_0017466 3300044683 Bacteria 3430
125 Ga0466965_0300026 3300044683 Bacteria 871
126 Ga0466965_0390798 3300044683 Bacteria 767
127 Ga0466965_0441039 3300044683 Bacteria 724
128 Ga0466965_0520961 3300044683 Bacteria 669
129 Ga0466965_0707608 3300044683 Bacteria 578
130 Ga0466966_0400149 3300044684 Bacteria 825
131 Ga0466966_0496460 3300044684 Bacteria 734
132 Ga0466966_0860693 3300044684 Bacteria 546
133 Ga0466961_0128093 3300044693 Bacteria 1592
134 Ga0466961_0562140 3300044693 Bacteria 687
135 Ga0466963_0015364 3300044694 Bacteria 4738
136 Ga0466963_0066920 3300044694 Bacteria 2410
137 Ga0466963_0098819 3300044694 Bacteria 1996
138 Ga0466963_0178838 3300044694 Bacteria 1481
139 Ga0466963_0282526 3300044694 Bacteria 1167
140 Ga0466963_0913402 3300044694 Bacteria 619
141 Ga0466963_0981063 3300044694 Bacteria 595
142 Ga0466963_1215464 3300044694 Bacteria 529
143 Ga0466964_0486805 3300044706 Bacteria 660
144 Ga0466964_0757512 3300044706 Bacteria 545
145 Ga0466971_0054257 3300044719 Bacteria 1806
146 Ga0466971_0353384 3300044719 Bacteria 711
147 Ga0466971_0618986 3300044719 Bacteria 541
148 Ga0466971_0629247 3300044719 Bacteria 536
149 Ga0466968_0165360 3300044735 Bacteria 1023
150 Ga0466968_0421475 3300044735 Bacteria 657
151 Ga0466968_0506925 3300044735 Bacteria 602
152 Ga0466970_0050052 3300044765 Bacteria 2228
153 Ga0466970_0131612 3300044765 Bacteria 1374
154 Ga0466970_0841298 3300044765 Bacteria 538
155 Ga0466970_0923252 3300044765 Bacteria 514
156 Ga0466957_0133463 3300044842 Bacteria 1593
157 Ga0466957_0270450 3300044842 Bacteria 1135
158 Ga0466957_0271241 3300044842 Bacteria 1133
159 Ga0466957_0599599 3300044842 Bacteria 771
160 Ga0466957_0743255 3300044842 Bacteria 694
161 Ga0466960_0015566 3300044901 Bacteria 3281
162 Ga0466960_0046336 3300044901 Bacteria 2081
163 Ga0466960_0255703 3300044901 Bacteria 974
164 Ga0466960_0334245 3300044901 Bacteria 861
165 Ga0466959_0060072 3300045049 Bacteria 2766
166 Ga0466959_0185041 3300045049 Bacteria 1456
167 Ga0466959_0333105 3300045049 Bacteria 1036
168 Ga0466959_0452999 3300045049 Bacteria 870
169 Ga0466967_0086844 3300045976 Bacteria 2835
170 Ga0466967_0099128 3300045976 Bacteria 2661
171 Ga0466967_0212226 3300045976 Bacteria 1836
172 Ga0466967_0248817 3300045976 Bacteria 1697
173 Ga0466967_0317142 3300045976 Bacteria 1503
174 Ga0466967_0747330 3300045976 Bacteria 970
175 Ga0466967_1096453 3300045976 Bacteria 793
176 Ga0466967_1210932 3300045976 Bacteria 752
177 Ga0466967_1805799 3300045976 Bacteria 609
178 Ga0466967_2492748 3300045976 Bacteria 512
179 Ga0496100_0426414 3300048903 Bacteria 1014
180 Ga0496101_0961741 3300048904 Bacteria 672
181 Ga0496108_0970766 3300048911 Bacteria 727
182 Ga0496109_0403203 3300048912 Bacteria 1292
183 Ga0496109_0424924 3300048912 Bacteria 1255
184 Ga0496110_1435736 3300048913 Bacteria 600
185 Ga0496114_1633072 3300048917 Bacteria 533
186 Ga0501031_0187538 3300049568 Bacteria 1351
187 nmdc:mga03n38_860442_c1 3300050490 Unclassified 531
188 nmdc:mga08y16_301631_c1 3300050511 Bacteria 1651
189 nmdc:mga0n895_708023_c1 3300050512 Bacteria 1002
190 nmdc:mga0rr50_976962_c1 3300050513 Bacteria 722
191 Ga0466962_0024874 3300061719 Bacteria 2875
192 Ga0466962_0202270 3300061719 Bacteria 971
193 Ga0466962_0294983 3300061719 Bacteria 801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100183172 Ga0070665_1001831723 68
2 3300005840 Ga0068870_10530161 Ga0068870_105301612 68
3 3300013308 Ga0157375_10287548 Ga0157375_102875482 68
4 3300028379 Ga0268266_10298996 Ga0268266_102989962 68
5 3300028381 Ga0268264_11664559 Ga0268264_116645591 68
6 3300031824 Ga0307413_11854583 Ga0307413_118545832 68
7 3300032004 Ga0307414_10214691 Ga0307414_102146912 68
8 3300041460 Ga0451802_0890438 Ga0451802_0890438_214_420 68
9 3300041512 Ga0451853_3330384 Ga0451853_3330384_12_221 68
10 3300044656 Ga0466969_0095019 Ga0466969_0095019_1128_1346 68
11 3300044683 Ga0466965_0441039 Ga0466965_0441039_138_344 68
12 3300044684 Ga0466966_0400149 Ga0466966_0400149_472_690 68
13 3300044684 Ga0466966_0496460 Ga0466966_0496460_90_296 68
14 3300044693 Ga0466961_0128093 Ga0466961_0128093_1120_1341 68
15 3300044694 Ga0466963_0066920 Ga0466963_0066920_252_458 68
16 3300044694 Ga0466963_0098819 Ga0466963_0098819_1640_1846 68
17 3300044694 Ga0466963_0282526 Ga0466963_0282526_540_746 68
18 3300044719 Ga0466971_0629247 Ga0466971_0629247_237_455 68
19 3300044765 Ga0466970_0923252 Ga0466970_0923252_69_275 68
20 3300044842 Ga0466957_0270450 Ga0466957_0270450_496_702 68
21 3300045049 Ga0466959_0185041 Ga0466959_0185041_291_497 68
22 3300045049 Ga0466959_0452999 Ga0466959_0452999_106_324 68
23 3300045976 Ga0466967_0317142 Ga0466967_0317142_767_973 68
24 3300045976 Ga0466967_0747330 Ga0466967_0747330_167_373 68
25 3300045976 Ga0466967_1805799 Ga0466967_1805799_134_340 68
26 3300005329 Ga0070683_100346009 Ga0070683_1003460092 69
27 3300005334 Ga0068869_100919326 Ga0068869_1009193262 69
28 3300005339 Ga0070660_100274812 Ga0070660_1002748121 69
29 3300005840 Ga0068870_10575797 Ga0068870_105757971 69
30 3300006881 Ga0068865_101414800 Ga0068865_1014148002 69
31 3300009094 Ga0111539_11726985 Ga0111539_117269851 69
32 3300009098 Ga0105245_10426456 Ga0105245_104264562 69
33 3300011119 Ga0105246_11953239 Ga0105246_119532391 69
34 3300012482 Ga0157318_1004840 Ga0157318_10048402 69
35 3300012497 Ga0157319_1030520 Ga0157319_10305202 69
36 3300012507 Ga0157342_1040011 Ga0157342_10400111 69
37 3300012512 Ga0157327_1057667 Ga0157327_10576672 69
38 3300013307 Ga0157372_12586700 Ga0157372_125867002 69
39 3300014326 Ga0157380_11520223 Ga0157380_115202232 69
40 3300021377 Ga0213874_10327332 Ga0213874_103273321 69
41 3300021388 Ga0213875_10000745 Ga0213875_100007453 69
42 3300025919 Ga0207657_10244546 Ga0207657_102445462 69
43 3300025944 Ga0207661_10673288 Ga0207661_106732882 69
44 3300026023 Ga0207677_10552442 Ga0207677_105524422 69
45 3300031901 Ga0307406_11267568 Ga0307406_112675681 69
46 3300031903 Ga0307407_10902799 Ga0307407_109027991 69
47 3300031995 Ga0307409_100657072 Ga0307409_1006570721 69
48 3300032004 Ga0307414_11566444 Ga0307414_115664442 69
49 3300032126 Ga0307415_100830462 Ga0307415_1008304622 69
50 3300032126 Ga0307415_101240023 Ga0307415_1012400231 69
51 3300035092 Ga0373952_0134587 Ga0373952_0134587_254_463 69
52 3300035691 Ga0373931_0120009 Ga0373931_0120009_447_656 69
53 3300037853 Ga0436364_1223233 Ga0436364_1223233_32096_32311 69
54 3300039437 Ga0436365_1845293 Ga0436365_1845293_503_712 69
55 3300039450 Ga0436363_1223189 Ga0436363_1223189_300_515 69
56 3300039450 Ga0436363_1253558 Ga0436363_1253558_24_233 69
57 3300044656 Ga0466969_0107152 Ga0466969_0107152_460_669 69
58 3300044656 Ga0466969_0613172 Ga0466969_0613172_30_239 69
59 3300044658 Ga0466972_0212284 Ga0466972_0212284_544_819 69
60 3300044658 Ga0466972_0356174 Ga0466972_0356174_84_299 69
61 3300044683 Ga0466965_0017466 Ga0466965_0017466_686_895 69
62 3300044683 Ga0466965_0300026 Ga0466965_0300026_617_832 69
63 3300044683 Ga0466965_0707608 Ga0466965_0707608_326_535 69
64 3300044684 Ga0466966_0860693 Ga0466966_0860693_206_415 69
65 3300044693 Ga0466961_0562140 Ga0466961_0562140_434_643 69
66 3300044694 Ga0466963_0015364 Ga0466963_0015364_1371_1580 69
67 3300044694 Ga0466963_0913402 Ga0466963_0913402_218_427 69
68 3300044694 Ga0466963_1215464 Ga0466963_1215464_245_454 69
69 3300044706 Ga0466964_0486805 Ga0466964_0486805_299_508 69
70 3300044706 Ga0466964_0757512 Ga0466964_0757512_297_506 69
71 3300044719 Ga0466971_0054257 Ga0466971_0054257_146_355 69
72 3300044719 Ga0466971_0353384 Ga0466971_0353384_364_573 69
73 3300044719 Ga0466971_0618986 Ga0466971_0618986_254_463 69
74 3300044735 Ga0466968_0165360 Ga0466968_0165360_633_848 69
75 3300044735 Ga0466968_0421475 Ga0466968_0421475_222_431 69
76 3300044735 Ga0466968_0506925 Ga0466968_0506925_134_346 69
77 3300044765 Ga0466970_0050052 Ga0466970_0050052_431_640 69
78 3300044765 Ga0466970_0131612 Ga0466970_0131612_718_927 69
79 3300044765 Ga0466970_0841298 Ga0466970_0841298_37_252 69
80 3300044842 Ga0466957_0133463 Ga0466957_0133463_490_699 69
81 3300044842 Ga0466957_0271241 Ga0466957_0271241_146_379 69
82 3300044842 Ga0466957_0743255 Ga0466957_0743255_39_254 69
83 3300044901 Ga0466960_0015566 Ga0466960_0015566_2899_3123 69
84 3300044901 Ga0466960_0046336 Ga0466960_0046336_1560_1769 69
85 3300044901 Ga0466960_0255703 Ga0466960_0255703_548_757 69
86 3300044901 Ga0466960_0334245 Ga0466960_0334245_327_536 69
87 3300045049 Ga0466959_0060072 Ga0466959_0060072_1025_1234 69
88 3300045049 Ga0466959_0333105 Ga0466959_0333105_226_435 69
89 3300045976 Ga0466967_0212226 Ga0466967_0212226_161_370 69
90 3300045976 Ga0466967_1096453 Ga0466967_1096453_51_260 69
91 3300049568 Ga0501031_0187538 Ga0501031_0187538_1129_1338 69
92 3300050513 nmdc:mga0rr50_976962_c1 nmdc:mga0rr50_976962_c1_447_656 69
93 3300061719 Ga0466962_0024874 Ga0466962_0024874_1641_1850 69
94 3300061719 Ga0466962_0202270 Ga0466962_0202270_397_612 69
95 3300061719 Ga0466962_0294983 Ga0466962_0294983_353_562 69
96 3300005327 Ga0070658_10371707 Ga0070658_103717072 70
97 3300005329 Ga0070683_100478146 Ga0070683_1004781463 70
98 3300005329 Ga0070683_100717866 Ga0070683_1007178661 70
99 3300005331 Ga0070670_101432399 Ga0070670_1014323992 70
100 3300005337 Ga0070682_100025148 Ga0070682_1000251485 70
101 3300005337 Ga0070682_101354783 Ga0070682_1013547831 70
102 3300005340 Ga0070689_100561003 Ga0070689_1005610031 70
103 3300005354 Ga0070675_101186217 Ga0070675_1011862172 70
104 3300005365 Ga0070688_100447747 Ga0070688_1004477472 70
105 3300005441 Ga0070700_100345001 Ga0070700_1003450012 70
106 3300005457 Ga0070662_100757777 Ga0070662_1007577771 70
107 3300005459 Ga0068867_102136323 Ga0068867_1021363231 70
108 3300005466 Ga0070685_10096400 Ga0070685_100964001 70
109 3300005466 Ga0070685_10876189 Ga0070685_108761892 70
110 3300005547 Ga0070693_100576026 Ga0070693_1005760262 70
111 3300005548 Ga0070665_100133377 Ga0070665_1001333772 70
112 3300005548 Ga0070665_100469500 Ga0070665_1004695001 70
113 3300005577 Ga0068857_101088215 Ga0068857_1010882151 70
114 3300005577 Ga0068857_101301639 Ga0068857_1013016391 70
115 3300005578 Ga0068854_100099062 Ga0068854_1000990624 70
116 3300005617 Ga0068859_100308514 Ga0068859_1003085142 70
117 3300005718 Ga0068866_10618296 Ga0068866_106182962 70
118 3300005719 Ga0068861_101951215 Ga0068861_1019512152 70
119 3300005834 Ga0068851_10148386 Ga0068851_101483863 70
120 3300005842 Ga0068858_101258770 Ga0068858_1012587702 70
121 3300006844 Ga0075428_101626081 Ga0075428_1016260812 70
122 3300006871 Ga0075434_100952939 Ga0075434_1009529391 70
123 3300006881 Ga0068865_100242875 Ga0068865_1002428752 70
124 3300006881 Ga0068865_101124464 Ga0068865_1011244641 70
125 3300006931 Ga0097620_100308539 Ga0097620_1003085392 70
126 3300009094 Ga0111539_10228867 Ga0111539_102288672 70
127 3300009101 Ga0105247_10372642 Ga0105247_103726421 70
128 3300009148 Ga0105243_10357990 Ga0105243_103579902 70
129 3300009148 Ga0105243_11378707 Ga0105243_113787072 70
130 3300009148 Ga0105243_12487753 Ga0105243_124877532 70
131 3300009174 Ga0105241_10825971 Ga0105241_108259712 70
132 3300009176 Ga0105242_10659306 Ga0105242_106593061 70
133 3300009177 Ga0105248_13002243 Ga0105248_130022432 70
134 3300009545 Ga0105237_10525349 Ga0105237_105253492 70
135 3300009553 Ga0105249_10823968 Ga0105249_108239682 70
136 3300010375 Ga0105239_12527022 Ga0105239_125270221 70
137 3300011119 Ga0105246_10222727 Ga0105246_102227272 70
138 3300012515 Ga0157338_1070787 Ga0157338_10707872 70
139 3300013105 Ga0157369_11194146 Ga0157369_111941462 70
140 3300013306 Ga0163162_11465620 Ga0163162_114656202 70
141 3300013308 Ga0157375_11147096 Ga0157375_111470961 70
142 3300014325 Ga0163163_10335459 Ga0163163_103354592 70
143 3300014745 Ga0157377_10431842 Ga0157377_104318421 70
144 3300014745 Ga0157377_11033009 Ga0157377_110330092 70
145 3300014969 Ga0157376_12086752 Ga0157376_120867521 70
146 3300017792 Ga0163161_10945187 Ga0163161_109451871 70
147 3300020070 Ga0206356_10323499 Ga0206356_103234992 70
148 3300020082 Ga0206353_10015334 Ga0206353_100153342 70
149 3300020082 Ga0206353_10546405 Ga0206353_105464052 70
150 3300025899 Ga0207642_10217024 Ga0207642_102170241 70
151 3300025901 Ga0207688_10111646 Ga0207688_101116463 70
152 3300025901 Ga0207688_10289006 Ga0207688_102890062 70
153 3300025908 Ga0207643_10251512 Ga0207643_102515121 70
154 3300025926 Ga0207659_10374354 Ga0207659_103743542 70
155 3300025932 Ga0207690_11093421 Ga0207690_110934212 70
156 3300025936 Ga0207670_11405932 Ga0207670_114059322 70
157 3300025940 Ga0207691_10218001 Ga0207691_102180012 70
158 3300025942 Ga0207689_10175116 Ga0207689_101751162 70
159 3300025944 Ga0207661_10387954 Ga0207661_103879543 70
160 3300025961 Ga0207712_10535307 Ga0207712_105353072 70
161 3300025961 Ga0207712_11165725 Ga0207712_111657251 70
162 3300026067 Ga0207678_10147034 Ga0207678_101470342 70
163 3300026075 Ga0207708_10031646 Ga0207708_100316465 70
164 3300026095 Ga0207676_10175537 Ga0207676_101755373 70
165 3300026116 Ga0207674_10894698 Ga0207674_108946982 70
166 3300026118 Ga0207675_100277958 Ga0207675_1002779582 70
167 3300026121 Ga0207683_10091141 Ga0207683_100911413 70
168 3300026121 Ga0207683_10392149 Ga0207683_103921492 70
169 3300026142 Ga0207698_10097238 Ga0207698_100972382 70
170 3300031903 Ga0307407_11292184 Ga0307407_112921841 70
171 3300039450 Ga0436363_1096608 Ga0436363_1096608_519_731 70
172 3300041451 Ga0451791_1936707 Ga0451791_1936707_134_346 70
173 3300041486 Ga0451807_1090760 Ga0451807_1090760_204_419 70
174 3300044683 Ga0466965_0390798 Ga0466965_0390798_20_238 70
175 3300044683 Ga0466965_0520961 Ga0466965_0520961_241_453 70
176 3300044694 Ga0466963_0178838 Ga0466963_0178838_670_888 70
177 3300044694 Ga0466963_0981063 Ga0466963_0981063_140_358 70
178 3300044842 Ga0466957_0599599 Ga0466957_0599599_289_510 70
179 3300045976 Ga0466967_0086844 Ga0466967_0086844_927_1139 70
180 3300045976 Ga0466967_0099128 Ga0466967_0099128_2204_2416 70
181 3300045976 Ga0466967_0248817 Ga0466967_0248817_1183_1401 70
182 3300045976 Ga0466967_1210932 Ga0466967_1210932_208_426 70
183 3300045976 Ga0466967_2492748 Ga0466967_2492748_269_487 70
184 3300048903 Ga0496100_0426414 Ga0496100_0426414_720_932 70
185 3300048904 Ga0496101_0961741 Ga0496101_0961741_429_641 70
186 3300048911 Ga0496108_0970766 Ga0496108_0970766_46_258 70
187 3300048912 Ga0496109_0403203 Ga0496109_0403203_176_391 70
188 3300048912 Ga0496109_0424924 Ga0496109_0424924_950_1162 70
189 3300048913 Ga0496110_1435736 Ga0496110_1435736_195_413 70
190 3300048917 Ga0496114_1633072 Ga0496114_1633072_268_480 70
191 3300050490 nmdc:mga03n38_860442_c1 nmdc:mga03n38_860442_c1_37_255 70
192 3300050511 nmdc:mga08y16_301631_c1 nmdc:mga08y16_301631_c1_1386_1598 70
193 3300050512 nmdc:mga0n895_708023_c1 nmdc:mga0n895_708023_c1_457_669 70
194 iso_pu_bacteria 2891562705 2891568493 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11160

Hva1_TUDOR

Hypervirulence associated proteins TUDOR domain

20

78

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vy1-assembly2.cif.gz_B crystal structure of the extended tudor domain from bmpapi 0.8407 7 67
7un3-assembly1.cif.gz_A complex of ube2o with nap1l1 and ubiquitylated ul2 0.8357 6 70
5t45-assembly1.cif.gz_A chicken smooth muscle myosin motor domain co-crystallized with the specific ck-571 inhibitor, mgadp.befx form 0.8256 11 69
5m05-assembly1.cif.gz_A chicken smooth muscle myosin motor domain co-crystallized with the specific ck-571 inhibitor, mgadp form 0.8246 11 69
5ygf-assembly1.cif.gz_A crystal structure of drosophila melanogaster papi extended tudor domain (d287a) in complex with piwi n-terminal r10-unme peptide 0.8212 7 67
ID Description Score Start End Superfamily
af_K7K6T0_75_151_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8829 6 70 2.30.30.140
af_Q9FFA0_84_140_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8787 7 70 2.30.30.140
af_C4JC55_378_443_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8689 7 70 2.30.30.140
af_I1JUF7_74_122_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8678 10 70 2.30.30.140
af_P32944_409_523_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8377 46 63 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1R0KZ91-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 1.009 6 70
AF-A0A3T1AVW8-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 0.9956 7 70
AF-A0A1A0RKF9-F1-model_v4 deleted 0.9947 6 70
AF-A0A1B2HBG9-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 0.9945 4 69
AF-A0A0M8UFS4-F1-model_v4 deleted 0.9932 8 70

Feature Viewer

pLDDT pTM Quality
92.12 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map