F297712

General Info

Members Datasets Scaffolds Average Seq Length
193 129 179 256

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0367500|Ga0496115_0367500_264_1115
Length 283
Sequence MSPDSSVMLDVTSERRDPHAMLTISQLASYAGVTVRAVRHYHAKGLLPEPERDYSGYRRYDARAVVELIKIRTLAESGVPLARVQELLGADEEEFATAVAEIDRRLRREIRERQEHRRQIAKLAAGDSLSVPSDVVDYLDQMRARGVPEALVEGERDGWILMAARWPDKIPELMADKQAQLEDPRTVQLYQLIGDLLELGPDEERLNAVADLIAEIAEQAAERGDLDRQNEDLDDDAFVALIDSFASDSHPLVERLQGLMAERGWSGWARMEKADAPTDHSAP

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2738541305 Nocardioides sp. CF167 Isolate Unclassified
4 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
5 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
6 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
7 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
8 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
9 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
10 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
11 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
62 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
86 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
89 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 8002784119 Frankia sp. AgB1.9 Isolate Nodule
128 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
129 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.67
Metatranscriptomes 2.07
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 1.55
Rhizoplane 16.58
Rhizosphere 60.62
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1088897 3300003578 Bacteria 1861
2 Ga0006562J51391_1114222 3300003578 Bacteria 1960
3 Ga0070683_100076586 3300005329 Bacteria 3127
4 Ga0070714_100316654 3300005435 Bacteria 1458
5 Ga0070714_100620892 3300005435 Bacteria 1039
6 Ga0070663_100230772 3300005455 Bacteria 1457
7 Ga0070698_100000777 3300005471 Bacteria 34609
8 Ga0070684_100030490 3300005535 Bacteria 4582
9 Ga0070665_100000739 3300005548 Bacteria 43504
10 Ga0070665_100119783 3300005548 Bacteria 2634
11 Ga0068852_100475438 3300005616 Bacteria 1241
12 Ga0068859_100000309 3300005617 Bacteria 48709
13 Ga0068862_100000009 3300005844 Bacteria 298620
14 Ga0075365_10038734 3300006038 Bacteria 3101
15 Ga0075365_10056617 3300006038 Bacteria 2607
16 Ga0075365_10132340 3300006038 Bacteria 1727
17 Ga0075368_10022375 3300006042 Bacteria 2407
18 Ga0075363_100020092 3300006048 Bacteria 3347
19 Ga0075364_10001762 3300006051 Bacteria 11960
20 Ga0075364_10084104 3300006051 Bacteria 2106
21 Ga0075364_10134917 3300006051 Bacteria 1658
22 Ga0075367_10081855 3300006178 Bacteria 1954
23 Ga0075367_10112097 3300006178 Bacteria 1675
24 Ga0075431_100177975 3300006847 Bacteria 2183
25 Ga0097620_100000309 3300006931 Bacteria 48709
26 Ga0105240_10067569 3300009093 Bacteria 4430
27 Ga0105245_10241622 3300009098 Bacteria 1750
28 Ga0105243_10036037 3300009148 Bacteria 3837
29 Ga0105241_10126741 3300009174 Bacteria 2062
30 Ga0105249_10007112 3300009553 Bacteria 9768
31 Ga0105249_10041668 3300009553 Bacteria 4175
32 Ga0105246_10092084 3300011119 Bacteria 2187
33 Ga0163162_10030053 3300013306 Bacteria 5381
34 Ga0157372_10762340 3300013307 Bacteria 1125
35 Ga0157375_10244145 3300013308 Bacteria 1955
36 Ga0157375_10399520 3300013308 Bacteria 1541
37 Ga0163163_10015198 3300014325 Bacteria 7110
38 Ga0206354_11317998 3300020081 Bacteria 1157
39 Ga0206353_10195324 3300020082 Bacteria 1435
40 Ga0207652_10379451 3300025921 Bacteria 1276
41 Ga0207687_10219919 3300025927 Bacteria 1495
42 Ga0207687_10315976 3300025927 Bacteria 1263
43 Ga0207709_10057473 3300025935 Bacteria 2412
44 Ga0207704_10323455 3300025938 Bacteria 1191
45 Ga0207661_10062556 3300025944 Bacteria 3012
46 Ga0207712_10063173 3300025961 Bacteria 2635
47 Ga0207678_10001053 3300026067 Bacteria 25256
48 Ga0207698_10223712 3300026142 Bacteria 1703
49 Ga0268266_10008465 3300028379 Bacteria 9145
50 Ga0268265_10000173 3300028380 Bacteria 77372
51 Ga0307408_100090498 3300031548 Bacteria 2309
52 Ga0307516_10188957 3300031730 Bacteria 1787
53 Ga0307405_10017735 3300031731 Bacteria 3914
54 Ga0307413_10253045 3300031824 Bacteria 1308
55 Ga0307412_10621671 3300031911 Bacteria 918
56 Ga0307409_100025985 3300031995 Bacteria 4120
57 Ga0307409_100794377 3300031995 Bacteria 953
58 Ga0307416_100030143 3300032002 Bacteria 4067
59 Ga0307411_10149668 3300032005 Bacteria 1733
60 Ga0307415_100143388 3300032126 Bacteria 1828
61 Ga0307415_100217928 3300032126 Bacteria 1528
62 Ga0395898_0204576 3300037466 Bacteria 1884
63 Ga0451843_0172676 3300041509 Bacteria 1065
64 Ga0451843_0733103 3300041509 Bacteria 3029
65 Ga0450907_018602 3300042146 Bacteria 1163
66 Ga0466963_0016002 3300044694 Bacteria 4657
67 Ga0466970_0027223 3300044765 Bacteria 2999
68 Ga0466957_0098175 3300044842 Bacteria 1843
69 Ga0466960_0017447 3300044901 Bacteria 3129
70 Ga0466967_0016674 3300045976 Bacteria 5801
71 Ga0466967_0085197 3300045976 Bacteria 2861
72 Ga0466967_0225807 3300045976 Bacteria 1781
73 Ga0466967_0306311 3300045976 Bacteria 1529
74 Ga0466967_0669089 3300045976 Bacteria 1027
75 Ga0495608_0224702 3300046511 Bacteria 1177
76 Ga0495635_0201859 3300046663 Bacteria 1348
77 Ga0496100_0010412 3300048903 Bacteria 5262
78 Ga0496100_0019733 3300048903 Bacteria 4028
79 Ga0496101_0006753 3300048904 Bacteria 7403
80 Ga0496101_0014373 3300048904 Bacteria 5318
81 Ga0496101_0072361 3300048904 Bacteria 2530
82 Ga0496102_0008838 3300048905 Bacteria 8642
83 Ga0496102_0013351 3300048905 Bacteria 7115
84 Ga0496102_0026850 3300048905 Bacteria 5139
85 Ga0496102_0143198 3300048905 Bacteria 2242
86 Ga0496103_0004520 3300048906 Bacteria 8429
87 Ga0496103_0305192 3300048906 Bacteria 1024
88 Ga0496104_0001896 3300048907 Bacteria 18117
89 Ga0496104_0025790 3300048907 Bacteria 5420
90 Ga0496105_0002045 3300048908 Bacteria 14588
91 Ga0496105_0012876 3300048908 Bacteria 6629
92 Ga0496106_0013055 3300048909 Bacteria 6130
93 Ga0496107_0011497 3300048910 Bacteria 6165
94 Ga0496107_0115774 3300048910 Bacteria 1973
95 Ga0496108_0104134 3300048911 Bacteria 2422
96 Ga0496109_0037425 3300048912 Bacteria 4383
97 Ga0496109_0145149 3300048912 Bacteria 2220
98 Ga0496109_0260231 3300048912 Bacteria 1634
99 Ga0496110_0088875 3300048913 Bacteria 2760
100 Ga0496110_0267768 3300048913 Bacteria 1555
101 Ga0496110_0446886 3300048913 Bacteria 1178
102 Ga0496111_0092005 3300048914 Bacteria 2223
103 Ga0496113_0097919 3300048916 Bacteria 2270
104 Ga0496114_0010297 3300048917 Bacteria 7442
105 Ga0496114_0018871 3300048917 Bacteria 5584
106 Ga0496114_0035459 3300048917 Bacteria 4119
107 Ga0496115_0014868 3300048918 Bacteria 5902
108 Ga0496115_0367500 3300048918 Bacteria 1171
109 Ga0496116_0000099 3300048919 Bacteria 195607
110 Ga0496117_0006315 3300048920 Bacteria 12057
111 Ga0496117_0083715 3300048920 Bacteria 2084
112 Ga0496118_0000465 3300048921 Bacteria 67189
113 Ga0496119_0002474 3300048922 Bacteria 20267
114 Ga0496120_0035098 3300048923 Bacteria 2999
115 Ga0501031_0036568 3300049568 Bacteria 3203
116 Ga0501034_0677173 3300049571 Bacteria 931
117 Ga0501036_0439458 3300049572 Bacteria 1087
118 Ga0501036_0673926 3300049572 Bacteria 855
119 Ga0501037_0113603 3300049573 Bacteria 1950
120 Ga0501037_0134802 3300049573 Bacteria 1769
121 Ga0501038_0034588 3300049574 Bacteria 4442
122 Ga0501038_0210651 3300049574 Bacteria 1555
123 Ga0501039_0022663 3300049575 Bacteria 4820
124 Ga0501040_0050261 3300049576 Bacteria 2851
125 Ga0501042_0174629 3300049578 Bacteria 1550
126 Ga0501046_0156478 3300049580 Bacteria 1716
127 Ga0501047_0145352 3300049581 Bacteria 2249
128 Ga0501048_0010696 3300049582 Bacteria 6843
129 Ga0501067_0008966 3300049583 Bacteria 5545
130 Ga0501067_0027648 3300049583 Bacteria 3143
131 Ga0501068_0006180 3300049584 Bacteria 6589
132 Ga0501068_0167133 3300049584 Bacteria 1387
133 Ga0501069_0001445 3300049585 Bacteria 11667
134 Ga0501069_0042308 3300049585 Bacteria 2520
135 Ga0501070_0000325 3300049586 Bacteria 43267
136 Ga0501070_0038104 3300049586 Bacteria 4012
137 Ga0501070_0068085 3300049586 Bacteria 2947
138 Ga0501070_0102039 3300049586 Bacteria 2372
139 Ga0501070_0462664 3300049586 Bacteria 1022
140 Ga0501071_0014456 3300049587 Bacteria 5399
141 Ga0501071_0098226 3300049587 Bacteria 2157
142 Ga0501071_0241219 3300049587 Bacteria 1363
143 Ga0501072_0045313 3300049588 Bacteria 3458
144 Ga0501073_0023110 3300049589 Bacteria 4469
145 Ga0501073_0031508 3300049589 Bacteria 3782
146 Ga0501074_0053014 3300049590 Bacteria 2927
147 Ga0501074_0174162 3300049590 Bacteria 1536
148 Ga0501076_0060557 3300049592 Bacteria 3012
149 Ga0501076_0088515 3300049592 Bacteria 2488
150 Ga0501077_0014704 3300049593 Bacteria 4918
151 Ga0501077_0042044 3300049593 Bacteria 2908
152 Ga0501079_0014405 3300049741 Bacteria 6029
153 Ga0501079_0021966 3300049741 Bacteria 4888
154 Ga0501080_0000096 3300049742 Bacteria 59454
155 Ga0501080_0006495 3300049742 Bacteria 10500
156 Ga0501080_0129752 3300049742 Bacteria 2333
157 Ga0501080_0224434 3300049742 Bacteria 1718
158 Ga0501080_0403225 3300049742 Bacteria 1230
159 Ga0501081_0323517 3300049743 Bacteria 1134
160 Ga0501083_0009928 3300049744 Bacteria 6720
161 Ga0501045_0014518 3300049824 Bacteria 5583
162 nmdc:mga03683_119781_c1 3300050489 Bacteria 1169
163 nmdc:mga03683_25331_c1 3300050489 Bacteria 2329
164 nmdc:mga03n38_3533_c1 3300050490 Bacteria 5042
165 nmdc:mga03n38_45561_c1 3300050490 Bacteria 1932
166 nmdc:mga0yw44_389417_c1 3300050492 Bacteria 941
167 nmdc:mga0yw44_7570_c1 3300050492 Bacteria 5352
168 nmdc:mga0yw44_776_c1 3300050492 Bacteria 11836
169 nmdc:mga06z11_124949_c1 3300050494 Bacteria 1439
170 nmdc:mga06r32_138024_c1 3300050510 Bacteria 2413
171 Ga0495601_0474100 3300053077 Bacteria 809
172 Ga0500566_0000140 3300053094 Bacteria 37236
173 Ga0500616_0000107 3300053153 Bacteria 153426
174 Ga0500616_0000476 3300053153 Bacteria 51947
175 Ga0500616_0001807 3300053153 Bacteria 19448
176 Ga0501084_0001685 3300054114 Bacteria 17566
177 Ga0501084_0004047 3300054114 Bacteria 11943
178 Ga0501082_0073572 3300060353 Bacteria 2943
179 Ga0530510_0103150 3300061734 Bacteria 2086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100475438 Ga0068852_1004754382 226
2 3300026142 Ga0207698_10223712 Ga0207698_102237122 226
3 3300048913 Ga0496110_0446886 Ga0496110_0446886_154_918 226
4 3300050492 nmdc:mga0yw44_389417_c1 nmdc:mga0yw44_389417_c1_32_796 226
5 3300005455 Ga0070663_100230772 Ga0070663_1002307721 228
6 3300026067 Ga0207678_10001053 Ga0207678_1000105328 228
7 3300049580 Ga0501046_0156478 Ga0501046_0156478_631_1422 228
8 3300053077 Ga0495601_0474100 Ga0495601_0474100_67_765 228
9 3300006038 Ga0075365_10132340 Ga0075365_101323402 231
10 3300049585 Ga0501069_0001445 Ga0501069_0001445_8415_9188 232
11 3300049586 Ga0501070_0000325 Ga0501070_0000325_6265_7038 232
12 3300049742 Ga0501080_0000096 Ga0501080_0000096_5923_6696 232
13 3300013308 Ga0157375_10244145 Ga0157375_102441452 233
14 3300044901 Ga0466960_0017447 Ga0466960_0017447_772_1539 234
15 3300020082 Ga0206353_10195324 Ga0206353_101953242 235
16 3300025927 Ga0207687_10219919 Ga0207687_102199192 235
17 3300048906 Ga0496103_0305192 Ga0496103_0305192_56_823 235
18 3300048913 Ga0496110_0267768 Ga0496110_0267768_326_1093 235
19 3300048905 Ga0496102_0143198 Ga0496102_0143198_893_1657 236
20 3300048919 Ga0496116_0000099 Ga0496116_0000099_128893_129657 236
21 3300048920 Ga0496117_0006315 Ga0496117_0006315_10655_11419 236
22 3300048921 Ga0496118_0000465 Ga0496118_0000465_33905_34669 236
23 3300048922 Ga0496119_0002474 Ga0496119_0002474_9942_10706 236
24 3300048923 Ga0496120_0035098 Ga0496120_0035098_1064_1828 236
25 3300053153 Ga0500616_0000107 Ga0500616_0000107_23261_24025 239
26 3300020081 Ga0206354_11317998 Ga0206354_113179982 242
27 3300045976 Ga0466967_0306311 Ga0466967_0306311_317_1156 244
28 iso_pu_bacteria 2558860112 2558905674 244
29 3300031995 Ga0307409_100794377 Ga0307409_1007943772 245
30 iso_pu_bacteria 2919446982 2919447135 245
31 3300005535 Ga0070684_100030490 Ga0070684_1000304903 246
32 iso_pu_bacteria 8003314358 8003324306 246
33 3300009098 Ga0105245_10241622 Ga0105245_102416222 247
34 3300009148 Ga0105243_10036037 Ga0105243_100360375 247
35 3300009553 Ga0105249_10041668 Ga0105249_100416685 247
36 3300025921 Ga0207652_10379451 Ga0207652_103794512 247
37 3300025927 Ga0207687_10315976 Ga0207687_103159762 247
38 3300025935 Ga0207709_10057473 Ga0207709_100574732 247
39 3300025938 Ga0207704_10323455 Ga0207704_103234552 247
40 iso_pu_bacteria 8002784119 8002785310 247
41 iso_pu_bacteria 8055157932 8055160230 247
42 3300044694 Ga0466963_0016002 Ga0466963_0016002_3466_4257 248
43 iso_pu_bacteria 2517572101 2517764049 248
44 3300013308 Ga0157375_10399520 Ga0157375_103995202 249
45 3300032126 Ga0307415_100217928 Ga0307415_1002179281 249
46 3300041509 Ga0451843_0172676 Ga0451843_0172676_20_778 249
47 3300044765 Ga0466970_0027223 Ga0466970_0027223_1037_1798 249
48 3300049572 Ga0501036_0439458 Ga0501036_0439458_113_877 249
49 3300049587 Ga0501071_0241219 Ga0501071_0241219_105_869 249
50 iso_pu_bacteria 2818991458 2819664383 249
51 iso_pu_bacteria 2818991462 2819689834 249
52 iso_pu_bacteria 2773857762 2774395529 250
53 iso_pu_bacteria 2808606439 2809193634 250
54 iso_pu_bacteria 2811994878 2812348372 250
55 iso_pu_bacteria 2891968417 2891973919 250
56 3300005617 Ga0068859_100000309 Ga0068859_1000003096 251
57 3300005844 Ga0068862_100000009 Ga0068862_100000009223 251
58 3300006931 Ga0097620_100000309 Ga0097620_10000030946 251
59 3300009553 Ga0105249_10007112 Ga0105249_100071126 251
60 3300014325 Ga0163163_10015198 Ga0163163_100151985 251
61 3300025961 Ga0207712_10063173 Ga0207712_100631731 251
62 3300028380 Ga0268265_10000173 Ga0268265_1000017361 251
63 3300041509 Ga0451843_0733103 Ga0451843_0733103_437_1204 251
64 iso_pu_bacteria 2738541305 2738868876 251
65 3300048920 Ga0496117_0083715 Ga0496117_0083715_903_1688 252
66 3300053153 Ga0500616_0000476 Ga0500616_0000476_35086_35886 252
67 3300003578 Ga0006562J51391_1114222 Ga0006562J51391_11142223 253
68 3300005329 Ga0070683_100076586 Ga0070683_1000765862 253
69 3300005471 Ga0070698_100000777 Ga0070698_1000007779 253
70 3300005548 Ga0070665_100119783 Ga0070665_1001197834 253
71 3300009093 Ga0105240_10067569 Ga0105240_100675691 253
72 3300009174 Ga0105241_10126741 Ga0105241_101267412 253
73 3300013306 Ga0163162_10030053 Ga0163162_100300535 253
74 3300013307 Ga0157372_10762340 Ga0157372_107623401 253
75 3300025944 Ga0207661_10062556 Ga0207661_100625562 253
76 3300031548 Ga0307408_100090498 Ga0307408_1000904982 253
77 3300031731 Ga0307405_10017735 Ga0307405_100177354 253
78 3300031995 Ga0307409_100025985 Ga0307409_1000259852 253
79 3300032002 Ga0307416_100030143 Ga0307416_1000301433 253
80 3300032005 Ga0307411_10149668 Ga0307411_101496682 253
81 3300032126 Ga0307415_100143388 Ga0307415_1001433882 253
82 3300037466 Ga0395898_0204576 Ga0395898_0204576_723_1526 253
83 3300044842 Ga0466957_0098175 Ga0466957_0098175_507_1268 253
84 3300048903 Ga0496100_0019733 Ga0496100_0019733_1729_2502 253
85 3300048904 Ga0496101_0014373 Ga0496101_0014373_3023_3796 253
86 3300048905 Ga0496102_0026850 Ga0496102_0026850_2559_3332 253
87 3300048906 Ga0496103_0004520 Ga0496103_0004520_2752_3525 253
88 3300048907 Ga0496104_0025790 Ga0496104_0025790_3775_4548 253
89 3300048908 Ga0496105_0012876 Ga0496105_0012876_2270_3043 253
90 3300048910 Ga0496107_0115774 Ga0496107_0115774_212_985 253
91 3300048911 Ga0496108_0104134 Ga0496108_0104134_662_1435 253
92 3300048912 Ga0496109_0145149 Ga0496109_0145149_520_1293 253
93 3300048913 Ga0496110_0088875 Ga0496110_0088875_684_1457 253
94 3300048916 Ga0496113_0097919 Ga0496113_0097919_1263_2036 253
95 iso_pu_bacteria 2818991318 2819428557 253
96 3300005435 Ga0070714_100316654 Ga0070714_1003166542 254
97 3300005435 Ga0070714_100620892 Ga0070714_1006208922 254
98 3300005548 Ga0070665_100000739 Ga0070665_10000073922 254
99 3300006038 Ga0075365_10038734 Ga0075365_100387344 254
100 3300006038 Ga0075365_10056617 Ga0075365_100566172 254
101 3300006042 Ga0075368_10022375 Ga0075368_100223752 254
102 3300006048 Ga0075363_100020092 Ga0075363_1000200922 254
103 3300006051 Ga0075364_10001762 Ga0075364_100017626 254
104 3300006051 Ga0075364_10084104 Ga0075364_100841042 254
105 3300006051 Ga0075364_10134917 Ga0075364_101349172 254
106 3300006178 Ga0075367_10081855 Ga0075367_100818552 254
107 3300006178 Ga0075367_10112097 Ga0075367_101120972 254
108 3300006847 Ga0075431_100177975 Ga0075431_1001779752 254
109 3300011119 Ga0105246_10092084 Ga0105246_100920842 254
110 3300028379 Ga0268266_10008465 Ga0268266_100084658 254
111 3300031730 Ga0307516_10188957 Ga0307516_101889572 254
112 3300031824 Ga0307413_10253045 Ga0307413_102530451 254
113 3300031911 Ga0307412_10621671 Ga0307412_106216711 254
114 3300042146 Ga0450907_018602 Ga0450907_018602_308_1087 254
115 3300045976 Ga0466967_0016674 Ga0466967_0016674_1085_1972 254
116 3300045976 Ga0466967_0085197 Ga0466967_0085197_51_839 254
117 3300045976 Ga0466967_0225807 Ga0466967_0225807_127_897 254
118 3300045976 Ga0466967_0669089 Ga0466967_0669089_78_869 254
119 3300046511 Ga0495608_0224702 Ga0495608_0224702_119_895 254
120 3300046663 Ga0495635_0201859 Ga0495635_0201859_503_1279 254
121 3300048903 Ga0496100_0010412 Ga0496100_0010412_3109_3939 254
122 3300048904 Ga0496101_0006753 Ga0496101_0006753_2966_3778 254
123 3300048904 Ga0496101_0072361 Ga0496101_0072361_1352_2182 254
124 3300048905 Ga0496102_0008838 Ga0496102_0008838_5190_6020 254
125 3300048905 Ga0496102_0013351 Ga0496102_0013351_3921_4733 254
126 3300048907 Ga0496104_0001896 Ga0496104_0001896_7484_8296 254
127 3300048908 Ga0496105_0002045 Ga0496105_0002045_3627_4439 254
128 3300048909 Ga0496106_0013055 Ga0496106_0013055_3401_4231 254
129 3300048910 Ga0496107_0011497 Ga0496107_0011497_269_1099 254
130 3300048912 Ga0496109_0037425 Ga0496109_0037425_768_1580 254
131 3300048912 Ga0496109_0260231 Ga0496109_0260231_160_990 254
132 3300048914 Ga0496111_0092005 Ga0496111_0092005_77_868 254
133 3300048917 Ga0496114_0010297 Ga0496114_0010297_3042_3854 254
134 3300048917 Ga0496114_0018871 Ga0496114_0018871_4239_5030 254
135 3300048917 Ga0496114_0035459 Ga0496114_0035459_1780_2610 254
136 3300048918 Ga0496115_0014868 Ga0496115_0014868_1233_2063 254
137 3300048918 Ga0496115_0367500 Ga0496115_0367500_264_1115 254
138 3300049568 Ga0501031_0036568 Ga0501031_0036568_1716_2486 254
139 3300049571 Ga0501034_0677173 Ga0501034_0677173_64_837 254
140 3300049572 Ga0501036_0673926 Ga0501036_0673926_62_835 254
141 3300049573 Ga0501037_0113603 Ga0501037_0113603_681_1454 254
142 3300049573 Ga0501037_0134802 Ga0501037_0134802_69_851 254
143 3300049574 Ga0501038_0034588 Ga0501038_0034588_1092_1874 254
144 3300049574 Ga0501038_0210651 Ga0501038_0210651_612_1385 254
145 3300049575 Ga0501039_0022663 Ga0501039_0022663_305_1075 254
146 3300049576 Ga0501040_0050261 Ga0501040_0050261_1807_2589 254
147 3300049578 Ga0501042_0174629 Ga0501042_0174629_298_1068 254
148 3300049581 Ga0501047_0145352 Ga0501047_0145352_1200_1973 254
149 3300049582 Ga0501048_0010696 Ga0501048_0010696_1582_2364 254
150 3300049583 Ga0501067_0008966 Ga0501067_0008966_3677_4450 254
151 3300049583 Ga0501067_0027648 Ga0501067_0027648_1173_1946 254
152 3300049584 Ga0501068_0006180 Ga0501068_0006180_1820_2593 254
153 3300049584 Ga0501068_0167133 Ga0501068_0167133_135_908 254
154 3300049585 Ga0501069_0042308 Ga0501069_0042308_92_865 254
155 3300049586 Ga0501070_0038104 Ga0501070_0038104_209_985 254
156 3300049586 Ga0501070_0068085 Ga0501070_0068085_1377_2150 254
157 3300049586 Ga0501070_0102039 Ga0501070_0102039_402_1175 254
158 3300049586 Ga0501070_0462664 Ga0501070_0462664_221_991 254
159 3300049587 Ga0501071_0014456 Ga0501071_0014456_1493_2275 254
160 3300049587 Ga0501071_0098226 Ga0501071_0098226_996_1766 254
161 3300049588 Ga0501072_0045313 Ga0501072_0045313_12_785 254
162 3300049589 Ga0501073_0023110 Ga0501073_0023110_494_1267 254
163 3300049589 Ga0501073_0031508 Ga0501073_0031508_1633_2406 254
164 3300049590 Ga0501074_0053014 Ga0501074_0053014_2066_2839 254
165 3300049590 Ga0501074_0174162 Ga0501074_0174162_50_820 254
166 3300049592 Ga0501076_0060557 Ga0501076_0060557_1388_2158 254
167 3300049592 Ga0501076_0088515 Ga0501076_0088515_1569_2351 254
168 3300049593 Ga0501077_0014704 Ga0501077_0014704_808_1581 254
169 3300049593 Ga0501077_0042044 Ga0501077_0042044_193_966 254
170 3300049741 Ga0501079_0014405 Ga0501079_0014405_1971_2753 254
171 3300049741 Ga0501079_0021966 Ga0501079_0021966_2731_3504 254
172 3300049742 Ga0501080_0006495 Ga0501080_0006495_412_1185 254
173 3300049742 Ga0501080_0129752 Ga0501080_0129752_1439_2212 254
174 3300049742 Ga0501080_0224434 Ga0501080_0224434_297_1067 254
175 3300049742 Ga0501080_0403225 Ga0501080_0403225_399_1181 254
176 3300049743 Ga0501081_0323517 Ga0501081_0323517_283_1065 254
177 3300049744 Ga0501083_0009928 Ga0501083_0009928_4642_5415 254
178 3300049824 Ga0501045_0014518 Ga0501045_0014518_3126_3908 254
179 3300050489 nmdc:mga03683_119781_c1 nmdc:mga03683_119781_c1_253_1086 254
180 3300050489 nmdc:mga03683_25331_c1 nmdc:mga03683_25331_c1_929_1705 254
181 3300050490 nmdc:mga03n38_3533_c1 nmdc:mga03n38_3533_c1_513_1289 254
182 3300050490 nmdc:mga03n38_45561_c1 nmdc:mga03n38_45561_c1_388_1164 254
183 3300050492 nmdc:mga0yw44_7570_c1 nmdc:mga0yw44_7570_c1_1073_1849 254
184 3300050492 nmdc:mga0yw44_776_c1 nmdc:mga0yw44_776_c1_8864_9640 254
185 3300050494 nmdc:mga06z11_124949_c1 nmdc:mga06z11_124949_c1_420_1196 254
186 3300050510 nmdc:mga06r32_138024_c1 nmdc:mga06r32_138024_c1_561_1337 254
187 3300053094 Ga0500566_0000140 Ga0500566_0000140_30574_31350 254
188 3300053153 Ga0500616_0001807 Ga0500616_0001807_4326_5102 254
189 3300054114 Ga0501084_0001685 Ga0501084_0001685_1619_2395 254
190 3300054114 Ga0501084_0004047 Ga0501084_0004047_6374_7147 254
191 3300060353 Ga0501082_0073572 Ga0501082_0073572_519_1292 254
192 3300061734 Ga0530510_0103150 Ga0530510_0103150_178_960 254
193 3300003578 Ga0006562J51391_1088897 Ga0006562J51391_10888972 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

23

60

0.99

PF13411

MerR_1

MerR HTH family regulatory protein

22

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.9048 1 68
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9006 1 68
1q07-assembly1.cif.gz_A crystal structure of the au(i) form of e. coli cuer, a copper efflux regulator 0.8951 2 106
5i41-assembly1.cif.gz_B structure of the apo raca dna binding domain 0.8939 2 61
7tec-assembly1.cif.gz_A-2 structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom 0.8681 1 62
ID Description Score Start End Superfamily
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9048 2 68 1.10.1660.10
3iaoA01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8975 2 70 1.10.1660.10
1q07A00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8951 2 106 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8939 2 68 1.10.1660.10
5i41B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8939 2 61 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A3N1ZWT0-F1-model_v4 MerR-like DNA binding protein 0.9728 1 66 GO:0003677
GO:0003700
AF-A0A4R1VZN5-F1-model_v4 DNA-binding transcriptional MerR regulator 0.972 2 68 GO:0003677
GO:0003700
AF-A0A0P9VED7-F1-model_v4 Cu-responsive transcriptional regulator 0.9588 2 68 GO:0003677
GO:0003700
AF-A0A3L7WVP1-F1-model_v4 MerR family transcriptional regulator 0.9313 2 106 GO:0003677
GO:0003700
AF-A0A3D1NLL9-F1-model_v4 deleted 0.9259 2 105

Feature Viewer

pLDDT pTM Quality
86.97 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map