F297348

General Info

Members Datasets Scaffolds Average Seq Length
193 108 386 143

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10006942|Ga0265340_100069426
Length 161
Sequence MLHRRTRSSVSLPTKFMIKLLFILTVGLVFESTGVILLKKGMNVIGEMHGYNAAEIFRVIKVSATNPHILLGVFFEALFFLCLLILMSKSDISFLWPLTAFSFVFATFAAMIFLGETVSMVRWVGVILIMIGAAFISYSEHAKEKPALPTSNNQSRSDGGN

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
54 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 0.52
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 41.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10006942 3300031247 Bacteria 6182
2 rootH2_10131418 3300003320 Bacteria 1920
3 rootH1_10141195 3300003323 Bacteria 1351
4 Ga0070676_10351540 3300005328 Unclassified 1013
5 Ga0070680_100848704 3300005336 Unclassified 787
6 Ga0070689_100993065 3300005340 Unclassified 746
7 Ga0070688_100435361 3300005365 Bacteria 977
8 Ga0070714_100342162 3300005435 Unclassified 1403
9 Ga0070713_100052876 3300005436 Bacteria 3364
10 Ga0070711_100004003 3300005439 Bacteria 8667
11 Ga0070711_100353962 3300005439 Bacteria 1181
12 Ga0070711_100466990 3300005439 Unclassified 1035
13 Ga0070711_100480685 3300005439 Bacteria 1021
14 Ga0070711_101132175 3300005439 Unclassified 675
15 Ga0070705_101038857 3300005440 Unclassified 667
16 Ga0070707_101855024 3300005468 Unclassified 570
17 Ga0070684_100659402 3300005535 Unclassified 974
18 Ga0070697_100783330 3300005536 Unclassified 843
19 Ga0070686_101392738 3300005544 Bacteria 588
20 Ga0070686_101791588 3300005544 Unclassified 522
21 Ga0068856_100590134 3300005614 Unclassified 1132
22 Ga0068859_100260546 3300005617 Bacteria 1825
23 Ga0068859_100493146 3300005617 Unclassified 1320
24 Ga0068859_101259114 3300005617 Bacteria 815
25 Ga0068859_101469296 3300005617 Unclassified 752
26 Ga0068864_100090979 3300005618 Unclassified 2691
27 Ga0068863_100041408 3300005841 Bacteria 4380
28 Ga0070717_10717805 3300006028 Unclassified 908
29 Ga0070716_101343916 3300006173 Unclassified 579
30 Ga0070712_100397198 3300006175 Unclassified 1138
31 Ga0070712_101242696 3300006175 Unclassified 648
32 Ga0070712_101509075 3300006175 Unclassified 587
33 Ga0097621_100141903 3300006237 Unclassified 2053
34 Ga0068871_100218510 3300006358 Unclassified 1650
35 Ga0068871_100314522 3300006358 Bacteria 1377
36 Ga0097620_100260552 3300006931 Bacteria 1825
37 Ga0097620_100493116 3300006931 Unclassified 1320
38 Ga0097620_101259225 3300006931 Bacteria 815
39 Ga0097620_101468843 3300006931 Unclassified 752
40 Ga0099794_10290311 3300007265 Bacteria 846
41 Ga0105240_10017731 3300009093 Bacteria 9587
42 Ga0105245_11842301 3300009098 Unclassified 658
43 Ga0105242_10139032 3300009176 Bacteria 2105
44 Ga0105242_10568262 3300009176 Unclassified 1090
45 Ga0105242_11677738 3300009176 Unclassified 671
46 Ga0105248_12391720 3300009177 Bacteria 602
47 Ga0105238_10315044 3300009551 Bacteria 1550
48 Ga0099796_10298650 3300010159 Bacteria 682
49 Ga0157369_11221208 3300013105 Bacteria 767
50 Ga0157374_10254212 3300013296 Bacteria 1729
51 Ga0157374_11043287 3300013296 Unclassified 837
52 Ga0157378_10098411 3300013297 Bacteria 2667
53 Ga0157372_11677443 3300013307 Unclassified 731
54 Ga0157375_10046365 3300013308 Bacteria 4237
55 Ga0163163_10000027 3300014325 Bacteria 176970
56 Ga0163163_10021884 3300014325 Bacteria 6042
57 Ga0157379_10442528 3300014968 Unclassified 1199
58 Ga0157379_11178765 3300014968 Bacteria 736
59 Ga0157376_10165001 3300014969 Bacteria 2012
60 Ga0207695_10064737 3300025913 Unclassified 3762
61 Ga0207693_10974507 3300025915 Unclassified 648
62 Ga0207663_10283676 3300025916 Bacteria 1231
63 Ga0207694_10280323 3300025924 Bacteria 1369
64 Ga0207700_10260196 3300025928 Unclassified 1485
65 Ga0207700_10926912 3300025928 Unclassified 780
66 Ga0207664_10512149 3300025929 Unclassified 1075
67 Ga0207686_10105610 3300025934 Bacteria 1889
68 Ga0207686_10978343 3300025934 Unclassified 686
69 Ga0207670_10390837 3300025936 Unclassified 1110
70 Ga0207641_10076432 3300026088 Unclassified 2895
71 Ga0207676_10075216 3300026095 Unclassified 2724
72 Ga0207674_10012827 3300026116 Bacteria 9353
73 Ga0265337_1000067 3300028556 Bacteria 48544
74 Ga0265337_1005310 3300028556 Bacteria 5144
75 Ga0265337_1012070 3300028556 Bacteria 2949
76 Ga0265337_1014857 3300028556 Bacteria 2569
77 Ga0265337_1020852 3300028556 Unclassified 2049
78 Ga0265337_1037589 3300028556 Bacteria 1407
79 Ga0265337_1065845 3300028556 Unclassified 999
80 Ga0265326_10031743 3300028558 Bacteria 1505
81 Ga0265326_10216558 3300028558 Unclassified 551
82 Ga0265319_1000001 3300028563 Bacteria 549513
83 Ga0265319_1006550 3300028563 Bacteria 5379
84 Ga0265319_1189967 3300028563 Unclassified 631
85 Ga0265334_10052066 3300028573 Bacteria 1568
86 Ga0265334_10120088 3300028573 Bacteria 939
87 Ga0265334_10134479 3300028573 Bacteria 878
88 Ga0265334_10135413 3300028573 Unclassified 875
89 Ga0265318_10131866 3300028577 Unclassified 919
90 Ga0265323_10003093 3300028653 Bacteria 7401
91 Ga0265323_10007805 3300028653 Unclassified 4425
92 Ga0265323_10172740 3300028653 Unclassified 686
93 Ga0265322_10123364 3300028654 Bacteria 738
94 Ga0265336_10011266 3300028666 Bacteria 3047
95 Ga0265336_10049188 3300028666 Unclassified 1277
96 Ga0265336_10205332 3300028666 Unclassified 585
97 Ga0265338_10002530 3300028800 Bacteria 27106
98 Ga0265338_10003273 3300028800 Bacteria 23015
99 Ga0265338_10006094 3300028800 Bacteria 15481
100 Ga0265338_10010747 3300028800 Bacteria 10683
101 Ga0265338_10012902 3300028800 Bacteria 9491
102 Ga0265338_10015708 3300028800 Bacteria 8297
103 Ga0265338_10031563 3300028800 Bacteria 5191
104 Ga0265338_10060686 3300028800 Bacteria 3319
105 Ga0265338_10085503 3300028800 Bacteria 2628
106 Ga0265338_10090636 3300028800 Unclassified 2530
107 Ga0265338_10142286 3300028800 Unclassified 1877
108 Ga0265324_10000768 3300029957 Bacteria 21141
109 Ga0265324_10024390 3300029957 Bacteria 2147
110 Ga0265324_10115189 3300029957 Unclassified 913
111 Ga0265324_10140968 3300029957 Bacteria 819
112 Ga0265320_10029004 3300031240 Unclassified 2868
113 Ga0265320_10053571 3300031240 Bacteria 1949
114 Ga0265325_10111931 3300031241 Bacteria 1325
115 Ga0265325_10258022 3300031241 Bacteria 787
116 Ga0265325_10258182 3300031241 Bacteria 787
117 Ga0265329_10081313 3300031242 Bacteria 1026
118 Ga0265340_10000287 3300031247 Bacteria 26530
119 Ga0265340_10228171 3300031247 Bacteria 833
120 Ga0265339_10002164 3300031249 Bacteria 14256
121 Ga0265327_10027671 3300031251 Bacteria 3258
122 Ga0265316_10000659 3300031344 Bacteria 38376
123 Ga0265316_10003620 3300031344 Bacteria 15574
124 Ga0265316_10012416 3300031344 Bacteria 7640
125 Ga0265316_10099863 3300031344 Bacteria 2207
126 Ga0265316_10190471 3300031344 Unclassified 1524
127 Ga0265316_10549931 3300031344 Bacteria 822
128 Ga0265313_10001830 3300031595 Bacteria 19415
129 Ga0265313_10017202 3300031595 Unclassified 4119
130 Ga0265314_10022496 3300031711 Bacteria 4829
131 Ga0265342_10028902 3300031712 Bacteria 3447
132 Ga0373926_0037988 3300035083 Unclassified 1714
133 Ga0373944_0122008 3300035089 Unclassified 899
134 Ga0373923_0497466 3300035111 Unclassified 594
135 Ga0373931_0454009 3300035691 Unclassified 820
136 Ga0373935_0361985 3300035692 Unclassified 1036
137 Ga0373927_0016190 3300035695 Bacteria 4921
138 Ga0373927_0021820 3300035695 Bacteria 4196
139 Ga0373947_0151717 3300035725 Unclassified 1493
140 Ga0373925_0004773 3300037068 Bacteria 10207
141 Ga0373925_0005368 3300037068 Bacteria 9556
142 Ga0373925_1249542 3300037068 Unclassified 610
143 Ga0373925_1460493 3300037068 Unclassified 560
144 Ga0451577_0130919 3300042876 Bacteria 2250
145 Ga0451577_0272885 3300042876 Bacteria 1532
146 Ga0451577_0275692 3300042876 Unclassified 1523
147 Ga0453683_0668958 3300044673 Bacteria 679
148 Ga0453684_0010582 3300044712 Bacteria 15737
149 Ga0453684_0368745 3300044712 Bacteria 1615
150 Ga0451576_0063687 3300045051 Bacteria 3843
151 Ga0451576_0068813 3300045051 Bacteria 3684
152 Ga0451576_0090922 3300045051 Bacteria 3175
153 Ga0451576_0192319 3300045051 Bacteria 2131
154 Ga0451576_0338064 3300045051 Unclassified 1576
155 Ga0451576_0411931 3300045051 Unclassified 1418
156 Ga0451576_1062453 3300045051 Bacteria 848
157 Ga0451576_1158740 3300045051 Bacteria 808
158 Ga0451576_1216986 3300045051 Unclassified 786
159 Ga0495641_0046154 3300046461 Unclassified 2004
160 Ga0495651_0263046 3300046462 Bacteria 1173
161 Ga0495653_0570842 3300046463 Bacteria 698
162 Ga0495582_0131847 3300046473 Bacteria 1412
163 Ga0495639_0052129 3300046475 Bacteria 1862
164 Ga0495662_0346716 3300046476 Unclassified 730
165 Ga0495664_0714762 3300046477 Unclassified 592
166 Ga0495583_0378700 3300046506 Bacteria 557
167 Ga0495618_0389727 3300046514 Bacteria 854
168 Ga0495628_0075709 3300046516 Bacteria 2621
169 Ga0495630_0342637 3300046517 Bacteria 1144
170 Ga0495630_0742401 3300046517 Bacteria 750
171 Ga0495630_1386241 3300046517 Bacteria 529
172 Ga0495666_0080923 3300046526 Unclassified 1537
173 Ga0495645_0014455 3300046543 Bacteria 5600
174 Ga0495645_0238540 3300046543 Unclassified 1214
175 Ga0495622_0035811 3300046557 Bacteria 2314
176 Ga0495667_0024498 3300046559 Unclassified 4064
177 Ga0495667_0594933 3300046559 Unclassified 689
178 Ga0495647_0149397 3300046681 Bacteria 1001
179 Ga0495647_0277964 3300046681 Unclassified 750
180 Ga0495669_0122422 3300046684 Bacteria 1220
181 Ga0495669_0450559 3300046684 Unclassified 625
182 Ga0495613_0010682 3300046689 Bacteria 6809
183 Ga0495613_0520278 3300046689 Unclassified 799
184 Ga0495624_0361312 3300046690 Bacteria 873
185 Ga0495600_0316656 3300046809 Bacteria 982
186 Ga0495674_0363540 3300047319 Unclassified 1173
187 Ga0495675_0035451 3300047444 Bacteria 3187
188 Ga0495675_0179312 3300047444 Bacteria 1297
189 Ga0495684_0155171 3300047471 Unclassified 1710
190 Ga0496109_1055161 3300048912 Unclassified 750
191 Ga0495601_0147907 3300053077 Bacteria 1533
192 Ga0500650_0013898 3300053098 Bacteria 3390
193 Ga0500650_0113048 3300053098 Unclassified 1267
194 Ga0265340_10006942
195 rootH2_10131418
196 rootH1_10141195
197 Ga0070676_10351540
198 Ga0070680_100848704
199 Ga0070689_100993065
200 Ga0070688_100435361
201 Ga0070714_100342162
202 Ga0070713_100052876
203 Ga0070711_100004003
204 Ga0070711_100353962
205 Ga0070711_100466990
206 Ga0070711_100480685
207 Ga0070711_101132175
208 Ga0070705_101038857
209 Ga0070707_101855024
210 Ga0070684_100659402
211 Ga0070697_100783330
212 Ga0070686_101392738
213 Ga0070686_101791588
214 Ga0068856_100590134
215 Ga0068859_100260546
216 Ga0068859_100493146
217 Ga0068859_101259114
218 Ga0068859_101469296
219 Ga0068864_100090979
220 Ga0068863_100041408
221 Ga0070717_10717805
222 Ga0070716_101343916
223 Ga0070712_100397198
224 Ga0070712_101242696
225 Ga0070712_101509075
226 Ga0097621_100141903
227 Ga0068871_100218510
228 Ga0068871_100314522
229 Ga0097620_100260552
230 Ga0097620_100493116
231 Ga0097620_101259225
232 Ga0097620_101468843
233 Ga0099794_10290311
234 Ga0105240_10017731
235 Ga0105245_11842301
236 Ga0105242_10139032
237 Ga0105242_10568262
238 Ga0105242_11677738
239 Ga0105248_12391720
240 Ga0105238_10315044
241 Ga0099796_10298650
242 Ga0157369_11221208
243 Ga0157374_10254212
244 Ga0157374_11043287
245 Ga0157378_10098411
246 Ga0157372_11677443
247 Ga0157375_10046365
248 Ga0163163_10000027
249 Ga0163163_10021884
250 Ga0157379_10442528
251 Ga0157379_11178765
252 Ga0157376_10165001
253 Ga0207695_10064737
254 Ga0207693_10974507
255 Ga0207663_10283676
256 Ga0207694_10280323
257 Ga0207700_10260196
258 Ga0207700_10926912
259 Ga0207664_10512149
260 Ga0207686_10105610
261 Ga0207686_10978343
262 Ga0207670_10390837
263 Ga0207641_10076432
264 Ga0207676_10075216
265 Ga0207674_10012827
266 Ga0265337_1000067
267 Ga0265337_1005310
268 Ga0265337_1012070
269 Ga0265337_1014857
270 Ga0265337_1020852
271 Ga0265337_1037589
272 Ga0265337_1065845
273 Ga0265326_10031743
274 Ga0265326_10216558
275 Ga0265319_1000001
276 Ga0265319_1006550
277 Ga0265319_1189967
278 Ga0265334_10052066
279 Ga0265334_10120088
280 Ga0265334_10134479
281 Ga0265334_10135413
282 Ga0265318_10131866
283 Ga0265323_10003093
284 Ga0265323_10007805
285 Ga0265323_10172740
286 Ga0265322_10123364
287 Ga0265336_10011266
288 Ga0265336_10049188
289 Ga0265336_10205332
290 Ga0265338_10002530
291 Ga0265338_10003273
292 Ga0265338_10006094
293 Ga0265338_10010747
294 Ga0265338_10012902
295 Ga0265338_10015708
296 Ga0265338_10031563
297 Ga0265338_10060686
298 Ga0265338_10085503
299 Ga0265338_10090636
300 Ga0265338_10142286
301 Ga0265324_10000768
302 Ga0265324_10024390
303 Ga0265324_10115189
304 Ga0265324_10140968
305 Ga0265320_10029004
306 Ga0265320_10053571
307 Ga0265325_10111931
308 Ga0265325_10258022
309 Ga0265325_10258182
310 Ga0265329_10081313
311 Ga0265340_10000287
312 Ga0265340_10228171
313 Ga0265339_10002164
314 Ga0265327_10027671
315 Ga0265316_10000659
316 Ga0265316_10003620
317 Ga0265316_10012416
318 Ga0265316_10099863
319 Ga0265316_10190471
320 Ga0265316_10549931
321 Ga0265313_10001830
322 Ga0265313_10017202
323 Ga0265314_10022496
324 Ga0265342_10028902
325 Ga0373926_0037988
326 Ga0373944_0122008
327 Ga0373923_0497466
328 Ga0373931_0454009
329 Ga0373935_0361985
330 Ga0373927_0016190
331 Ga0373927_0021820
332 Ga0373947_0151717
333 Ga0373925_0004773
334 Ga0373925_0005368
335 Ga0373925_1249542
336 Ga0373925_1460493
337 Ga0451577_0130919
338 Ga0451577_0272885
339 Ga0451577_0275692
340 Ga0453683_0668958
341 Ga0453684_0010582
342 Ga0453684_0368745
343 Ga0451576_0063687
344 Ga0451576_0068813
345 Ga0451576_0090922
346 Ga0451576_0192319
347 Ga0451576_0338064
348 Ga0451576_0411931
349 Ga0451576_1062453
350 Ga0451576_1158740
351 Ga0451576_1216986
352 Ga0495641_0046154
353 Ga0495651_0263046
354 Ga0495653_0570842
355 Ga0495582_0131847
356 Ga0495639_0052129
357 Ga0495662_0346716
358 Ga0495664_0714762
359 Ga0495583_0378700
360 Ga0495618_0389727
361 Ga0495628_0075709
362 Ga0495630_0342637
363 Ga0495630_0742401
364 Ga0495630_1386241
365 Ga0495666_0080923
366 Ga0495645_0014455
367 Ga0495645_0238540
368 Ga0495622_0035811
369 Ga0495667_0024498
370 Ga0495667_0594933
371 Ga0495647_0149397
372 Ga0495647_0277964
373 Ga0495669_0122422
374 Ga0495669_0450559
375 Ga0495613_0010682
376 Ga0495613_0520278
377 Ga0495624_0361312
378 Ga0495600_0316656
379 Ga0495674_0363540
380 Ga0495675_0035451
381 Ga0495675_0179312
382 Ga0495684_0155171
383 Ga0496109_1055161
384 Ga0495601_0147907
385 Ga0500650_0013898
386 Ga0500650_0113048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

54

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8011 6 122
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.798 4 121
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.7731 4 122
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7677 6 122
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7652 4 121
ID Description Score Start End Superfamily
af_A0A0R0KAQ7_21_177_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8219 6 121 1.10.3730.20
af_A0A1D6N5I5_20_286_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8152 2 121 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8106 7 122 1.10.3730.20
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7985 4 121 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7978 4 122 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A1F2RAM3-F1-model_v4 EamA domain-containing protein 0.9381 3 121 GO:0016020
AF-A0A0S3U9S1-F1-model_v4 EamA domain-containing protein 0.9273 3 122 GO:0005886
GO:0022857
AF-A0A533XNV9-F1-model_v4 EamA domain-containing protein 0.9232 3 121 GO:0005886
GO:0022857
AF-A0A523WA59-F1-model_v4 EamA domain-containing protein 0.9183 3 108 GO:0005886
GO:0022857
AF-A0A1F2RAM3-F1-model_v4 EamA domain-containing protein 0.9163 3 121 GO:0016020

Map