F296872

General Info

Members Datasets Scaffolds Average Seq Length
193 155 386 122

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100147983|Ga0068853_1001479833
Length 139
Sequence MVIVHRRTKPQDAAELPCPDGCFRMFERRSQPLLNRRAFLRRLAGSTLTGIGLIAVSLFAGMLGYHFFEGLSAIDSFLNAAMLLGGMGPVEQPQTHAGKLFAGMYALYCGLAVIVVAGIIFAPVVHRLMHRFHLDSKDH

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
149 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 0
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 11.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100147983 3300005539 Bacteria 2112
2 JGI25406J46586_10076104 3300003203 Bacteria 1040
3 rootH1_10045010 3300003316 Bacteria 4341
4 Ga0065712_10161749 3300005290 Bacteria 1296
5 Ga0070658_10287371 3300005327 Bacteria 1401
6 Ga0070658_11155126 3300005327 Unclassified 673
7 Ga0070658_11913386 3300005327 Bacteria 512
8 Ga0070690_100204119 3300005330 Bacteria 1377
9 Ga0070690_101093504 3300005330 Bacteria 632
10 Ga0070670_100183845 3300005331 Bacteria 1815
11 Ga0070670_101333902 3300005331 Bacteria 657
12 Ga0068869_100253291 3300005334 Bacteria 1407
13 Ga0070666_10353057 3300005335 Unclassified 1052
14 Ga0070680_100339192 3300005336 Bacteria 1277
15 Ga0070660_100473736 3300005339 Bacteria 1040
16 Ga0070689_100174227 3300005340 Bacteria 1744
17 Ga0070689_100357108 3300005340 Bacteria 1227
18 Ga0070669_100464241 3300005353 Bacteria 1045
19 Ga0070669_101114825 3300005353 Unclassified 680
20 Ga0070675_100147154 3300005354 Bacteria 2018
21 Ga0070688_100011624 3300005365 Bacteria 4898
22 Ga0070688_100263338 3300005365 Bacteria 1232
23 Ga0070659_101502829 3300005366 Bacteria 600
24 Ga0070714_100634396 3300005435 Bacteria 1028
25 Ga0070710_10118926 3300005437 Bacteria 1597
26 Ga0070701_10283952 3300005438 Bacteria 1012
27 Ga0070700_100015932 3300005441 Bacteria 4272
28 Ga0070694_100491328 3300005444 Bacteria 975
29 Ga0070708_100953385 3300005445 Bacteria 805
30 Ga0070678_100147672 3300005456 Unclassified 1890
31 Ga0070678_101631608 3300005456 Bacteria 606
32 Ga0070681_10097963 3300005458 Bacteria 2879
33 Ga0068867_100075534 3300005459 Bacteria 2528
34 Ga0070707_100143983 3300005468 Bacteria 2320
35 Ga0070698_100009979 3300005471 Bacteria 10153
36 Ga0070699_100014512 3300005518 Bacteria 6776
37 Ga0070699_101600529 3300005518 Bacteria 597
38 Ga0070679_100003998 3300005530 Bacteria 13582
39 Ga0070672_100512004 3300005543 Bacteria 1039
40 Ga0070686_100179277 3300005544 Bacteria 1504
41 Ga0070665_100000132 3300005548 Bacteria 140229
42 Ga0070704_100113848 3300005549 Bacteria 2063
43 Ga0070704_100364236 3300005549 Bacteria 1224
44 Ga0070702_100589749 3300005615 Bacteria 831
45 Ga0068852_100847937 3300005616 Unclassified 929
46 Ga0068859_100213577 3300005617 Bacteria 2016
47 Ga0068859_100490996 3300005617 Bacteria 1323
48 Ga0068864_100006160 3300005618 Bacteria 9838
49 Ga0068861_100142606 3300005719 Bacteria 1957
50 Ga0068863_100010598 3300005841 Bacteria 8948
51 Ga0068860_100013078 3300005843 Bacteria 8145
52 Ga0068860_102000120 3300005843 Bacteria 601
53 Ga0068862_100047451 3300005844 Bacteria 3666
54 Ga0081539_10000513 3300005985 Bacteria 80514
55 Ga0070712_101550750 3300006175 Bacteria 579
56 Ga0068871_100748123 3300006358 Unclassified 898
57 Ga0075428_100264686 3300006844 Bacteria 1851
58 Ga0075431_101476050 3300006847 Bacteria 639
59 Ga0075429_100939221 3300006880 Bacteria 757
60 Ga0075436_100000891 3300006914 Bacteria 19851
61 Ga0075436_100063945 3300006914 Bacteria 2543
62 Ga0075436_100159093 3300006914 Bacteria 1592
63 Ga0075436_100298717 3300006914 Bacteria 1154
64 Ga0097620_100213580 3300006931 Bacteria 2016
65 Ga0097620_100491034 3300006931 Bacteria 1323
66 Ga0075435_100978538 3300007076 Bacteria 738
67 Ga0105240_10003248 3300009093 Bacteria 25440
68 Ga0105240_10011701 3300009093 Bacteria 12192
69 Ga0105240_10392304 3300009093 Bacteria 1565
70 Ga0111539_13075510 3300009094 Unclassified 539
71 Ga0114129_11157948 3300009147 Bacteria 965
72 Ga0105243_10164234 3300009148 Bacteria 1917
73 Ga0105241_10005239 3300009174 Bacteria 9578
74 Ga0105241_10026523 3300009174 Bacteria 4312
75 Ga0105248_10071308 3300009177 Bacteria 3903
76 Ga0105237_10122156 3300009545 Bacteria 2599
77 Ga0105238_10103376 3300009551 Bacteria 2830
78 Ga0105238_10144989 3300009551 Bacteria 2351
79 Ga0105249_10060295 3300009553 Bacteria 3480
80 Ga0105249_11146977 3300009553 Bacteria 848
81 Ga0105239_10038821 3300010375 Bacteria 5217
82 Ga0105246_10116205 3300011119 Bacteria 1974
83 Ga0157373_10965965 3300013100 Bacteria 634
84 Ga0157370_11308715 3300013104 Bacteria 653
85 Ga0157369_10000028 3300013105 Bacteria 213910
86 Ga0163162_10319271 3300013306 Bacteria 1686
87 Ga0163162_10530850 3300013306 Bacteria 1306
88 Ga0163163_10030558 3300014325 Bacteria 5191
89 Ga0157380_10227539 3300014326 Bacteria 1672
90 Ga0157379_10060813 3300014968 Bacteria 3378
91 Ga0207692_10735161 3300025898 Bacteria 642
92 Ga0207642_10377423 3300025899 Bacteria 843
93 Ga0207645_10077042 3300025907 Bacteria 2136
94 Ga0207705_10208964 3300025909 Bacteria 1480
95 Ga0207705_10290849 3300025909 Bacteria 1252
96 Ga0207705_11494221 3300025909 Bacteria 512
97 Ga0207654_10000432 3300025911 Bacteria 24010
98 Ga0207654_10046796 3300025911 Unclassified 2468
99 Ga0207707_10357491 3300025912 Bacteria 1258
100 Ga0207695_10016243 3300025913 Bacteria 8724
101 Ga0207671_10002002 3300025914 Bacteria 22452
102 Ga0207693_11165323 3300025915 Bacteria 583
103 Ga0207660_10109859 3300025917 Bacteria 2073
104 Ga0207662_10068601 3300025918 Bacteria 2141
105 Ga0207652_10151927 3300025921 Bacteria 2073
106 Ga0207646_10310855 3300025922 Bacteria 1424
107 Ga0207694_10033799 3300025924 Bacteria 3918
108 Ga0207694_10400967 3300025924 Bacteria 1140
109 Ga0207650_10578365 3300025925 Bacteria 943
110 Ga0207659_10087505 3300025926 Bacteria 2319
111 Ga0207664_10496453 3300025929 Bacteria 1093
112 Ga0207664_10765915 3300025929 Unclassified 868
113 Ga0207686_10151660 3300025934 Bacteria 1614
114 Ga0207709_10268240 3300025935 Bacteria 1255
115 Ga0207670_10701204 3300025936 Bacteria 838
116 Ga0207670_11113556 3300025936 Unclassified 667
117 Ga0207711_10282858 3300025941 Bacteria 1528
118 Ga0207689_10243497 3300025942 Bacteria 1487
119 Ga0207667_10592715 3300025949 Bacteria 1118
120 Ga0207712_10469064 3300025961 Bacteria 1071
121 Ga0207640_10765607 3300025981 Bacteria 833
122 Ga0207708_10050652 3300026075 Bacteria 3161
123 Ga0207641_10013952 3300026088 Bacteria 6588
124 Ga0207675_100413531 3300026118 Bacteria 1331
125 Ga0207675_100433791 3300026118 Bacteria 1300
126 Ga0207698_10817236 3300026142 Unclassified 935
127 Ga0268266_10002151 3300028379 Bacteria 21661
128 Ga0268264_10075455 3300028381 Bacteria 2867
129 Ga0265327_10000645 3300031251 Bacteria 56357
130 Ga0373934_0154342 3300035086 Bacteria 941
131 Ga0373940_0234177 3300035088 Bacteria 614
132 Ga0373923_0106034 3300035111 Bacteria 1244
133 Ga0373936_0547859 3300035113 Unclassified 541
134 Ga0373939_0244667 3300035114 Bacteria 696
135 Ga0373941_0387033 3300035115 Bacteria 576
136 Ga0373956_0163579 3300035119 Bacteria 1049
137 Ga0373957_0025070 3300035120 Bacteria 2146
138 Ga0373955_0027067 3300035172 Bacteria 2960
139 Ga0373924_0127530 3300035410 Bacteria 1106
140 Ga0373935_0742734 3300035692 Unclassified 723
141 Ga0373933_0015225 3300035724 Bacteria 4287
142 Ga0373937_0008540 3300036401 Bacteria 8897
143 Ga0395899_0152701 3300037312 Bacteria 1636
144 Ga0395905_0000015 3300037471 Bacteria 393880
145 Ga0395905_0678305 3300037471 Bacteria 933
146 Ga0439453_0008164 3300041408 Bacteria 1676
147 Ga0451853_2005509 3300041512 Unclassified 584
148 Ga0439435_0080274 3300042436 Bacteria 978
149 Ga0451577_0000033 3300042876 Bacteria 378714
150 Ga0451577_1166797 3300042876 Bacteria 688
151 Ga0453683_0448012 3300044673 Unclassified 835
152 Ga0453684_0000109 3300044712 Bacteria 361015
153 Ga0453684_0029661 3300044712 Bacteria 7756
154 Ga0453684_0679443 3300044712 Bacteria 1121
155 Ga0451576_0187856 3300045051 Bacteria 2157
156 Ga0451576_0424685 3300045051 Bacteria 1395
157 Ga0451576_1143110 3300045051 Bacteria 814
158 Ga0495629_0971282 3300046459 Unclassified 554
159 Ga0495580_0481976 3300046472 Bacteria 829
160 Ga0495605_0083446 3300046474 Bacteria 1491
161 Ga0495664_0352663 3300046477 Unclassified 886
162 Ga0495618_0555809 3300046514 Bacteria 687
163 Ga0495628_0698150 3300046516 Bacteria 717
164 Ga0495630_0182421 3300046517 Bacteria 1601
165 Ga0495598_0070609 3300046537 Unclassified 1099
166 Ga0495621_0000569 3300046539 Bacteria 9182
167 Ga0495667_0106710 3300046559 Bacteria 1810
168 Ga0495623_0248538 3300046679 Bacteria 1001
169 Ga0495646_0382564 3300046680 Bacteria 734
170 Ga0495647_0009093 3300046681 Bacteria 3355
171 Ga0495658_0007550 3300046683 Bacteria 5390
172 Ga0495658_0201387 3300046683 Bacteria 1241
173 Ga0495624_0573614 3300046690 Bacteria 673
174 Ga0495671_0080141 3300046692 Bacteria 1600
175 Ga0495600_0322836 3300046809 Bacteria 971
176 Ga0495604_0952109 3300047317 Bacteria 534
177 Ga0495674_0431989 3300047319 Bacteria 1060
178 Ga0495680_0792636 3300047322 Bacteria 619
179 Ga0495681_0041594 3300047470 Unclassified 2230
180 Ga0501042_1024787 3300049578 Unclassified 602
181 Ga0501070_0038432 3300049586 Bacteria 3993
182 Ga0501080_0391188 3300049742 Unclassified 1252
183 Ga0501083_0019102 3300049744 Bacteria 4772
184 Ga0501265_102456 3300049762 Bacteria 525
185 Ga0501204_053604 3300049850 Bacteria 624
186 nmdc:mga05p37_665244_c1 3300050507 Bacteria 1163
187 nmdc:mga09592_205133_c1 3300050508 Bacteria 1707
188 nmdc:mga08y16_889459_c1 3300050511 Unclassified 877
189 nmdc:mga08x19_126547_c1 3300050514 Bacteria 1716
190 nmdc:mga08x19_33372_c1 3300050514 Bacteria 3249
191 nmdc:mga08x19_59579_c1 3300050514 Bacteria 2472
192 Ga0495619_0502015 3300053085 Bacteria 834
193 Ga0500616_0025624 3300053153 Bacteria 3270
194 Ga0068853_100147983
195 JGI25406J46586_10076104
196 rootH1_10045010
197 Ga0065712_10161749
198 Ga0070658_10287371
199 Ga0070658_11155126
200 Ga0070658_11913386
201 Ga0070690_100204119
202 Ga0070690_101093504
203 Ga0070670_100183845
204 Ga0070670_101333902
205 Ga0068869_100253291
206 Ga0070666_10353057
207 Ga0070680_100339192
208 Ga0070660_100473736
209 Ga0070689_100174227
210 Ga0070689_100357108
211 Ga0070669_100464241
212 Ga0070669_101114825
213 Ga0070675_100147154
214 Ga0070688_100011624
215 Ga0070688_100263338
216 Ga0070659_101502829
217 Ga0070714_100634396
218 Ga0070710_10118926
219 Ga0070701_10283952
220 Ga0070700_100015932
221 Ga0070694_100491328
222 Ga0070708_100953385
223 Ga0070678_100147672
224 Ga0070678_101631608
225 Ga0070681_10097963
226 Ga0068867_100075534
227 Ga0070707_100143983
228 Ga0070698_100009979
229 Ga0070699_100014512
230 Ga0070699_101600529
231 Ga0070679_100003998
232 Ga0070672_100512004
233 Ga0070686_100179277
234 Ga0070665_100000132
235 Ga0070704_100113848
236 Ga0070704_100364236
237 Ga0070702_100589749
238 Ga0068852_100847937
239 Ga0068859_100213577
240 Ga0068859_100490996
241 Ga0068864_100006160
242 Ga0068861_100142606
243 Ga0068863_100010598
244 Ga0068860_100013078
245 Ga0068860_102000120
246 Ga0068862_100047451
247 Ga0081539_10000513
248 Ga0070712_101550750
249 Ga0068871_100748123
250 Ga0075428_100264686
251 Ga0075431_101476050
252 Ga0075429_100939221
253 Ga0075436_100000891
254 Ga0075436_100063945
255 Ga0075436_100159093
256 Ga0075436_100298717
257 Ga0097620_100213580
258 Ga0097620_100491034
259 Ga0075435_100978538
260 Ga0105240_10003248
261 Ga0105240_10011701
262 Ga0105240_10392304
263 Ga0111539_13075510
264 Ga0114129_11157948
265 Ga0105243_10164234
266 Ga0105241_10005239
267 Ga0105241_10026523
268 Ga0105248_10071308
269 Ga0105237_10122156
270 Ga0105238_10103376
271 Ga0105238_10144989
272 Ga0105249_10060295
273 Ga0105249_11146977
274 Ga0105239_10038821
275 Ga0105246_10116205
276 Ga0157373_10965965
277 Ga0157370_11308715
278 Ga0157369_10000028
279 Ga0163162_10319271
280 Ga0163162_10530850
281 Ga0163163_10030558
282 Ga0157380_10227539
283 Ga0157379_10060813
284 Ga0207692_10735161
285 Ga0207642_10377423
286 Ga0207645_10077042
287 Ga0207705_10208964
288 Ga0207705_10290849
289 Ga0207705_11494221
290 Ga0207654_10000432
291 Ga0207654_10046796
292 Ga0207707_10357491
293 Ga0207695_10016243
294 Ga0207671_10002002
295 Ga0207693_11165323
296 Ga0207660_10109859
297 Ga0207662_10068601
298 Ga0207652_10151927
299 Ga0207646_10310855
300 Ga0207694_10033799
301 Ga0207694_10400967
302 Ga0207650_10578365
303 Ga0207659_10087505
304 Ga0207664_10496453
305 Ga0207664_10765915
306 Ga0207686_10151660
307 Ga0207709_10268240
308 Ga0207670_10701204
309 Ga0207670_11113556
310 Ga0207711_10282858
311 Ga0207689_10243497
312 Ga0207667_10592715
313 Ga0207712_10469064
314 Ga0207640_10765607
315 Ga0207708_10050652
316 Ga0207641_10013952
317 Ga0207675_100413531
318 Ga0207675_100433791
319 Ga0207698_10817236
320 Ga0268266_10002151
321 Ga0268264_10075455
322 Ga0265327_10000645
323 Ga0373934_0154342
324 Ga0373940_0234177
325 Ga0373923_0106034
326 Ga0373936_0547859
327 Ga0373939_0244667
328 Ga0373941_0387033
329 Ga0373956_0163579
330 Ga0373957_0025070
331 Ga0373955_0027067
332 Ga0373924_0127530
333 Ga0373935_0742734
334 Ga0373933_0015225
335 Ga0373937_0008540
336 Ga0395899_0152701
337 Ga0395905_0000015
338 Ga0395905_0678305
339 Ga0439453_0008164
340 Ga0451853_2005509
341 Ga0439435_0080274
342 Ga0451577_0000033
343 Ga0451577_1166797
344 Ga0453683_0448012
345 Ga0453684_0000109
346 Ga0453684_0029661
347 Ga0453684_0679443
348 Ga0451576_0187856
349 Ga0451576_0424685
350 Ga0451576_1143110
351 Ga0495629_0971282
352 Ga0495580_0481976
353 Ga0495605_0083446
354 Ga0495664_0352663
355 Ga0495618_0555809
356 Ga0495628_0698150
357 Ga0495630_0182421
358 Ga0495598_0070609
359 Ga0495621_0000569
360 Ga0495667_0106710
361 Ga0495623_0248538
362 Ga0495646_0382564
363 Ga0495647_0009093
364 Ga0495658_0007550
365 Ga0495658_0201387
366 Ga0495624_0573614
367 Ga0495671_0080141
368 Ga0495600_0322836
369 Ga0495604_0952109
370 Ga0495674_0431989
371 Ga0495680_0792636
372 Ga0495681_0041594
373 Ga0501042_1024787
374 Ga0501070_0038432
375 Ga0501080_0391188
376 Ga0501083_0019102
377 Ga0501265_102456
378 Ga0501204_053604
379 nmdc:mga05p37_665244_c1
380 nmdc:mga09592_205133_c1
381 nmdc:mga08y16_889459_c1
382 nmdc:mga08x19_126547_c1
383 nmdc:mga08x19_33372_c1
384 nmdc:mga08x19_59579_c1
385 Ga0495619_0502015
386 Ga0500616_0025624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rbz-assembly1.cif.gz_B-2 mthk channel, ca2+-bound 0.9116 31 84
3rbz-assembly1.cif.gz_D-2 mthk channel, ca2+-bound 0.9024 28 88
5bki-assembly1.cif.gz_A blocker-free closed mthk channel in nanodisc 0.9024 26 105
8fz7-assembly1.cif.gz_A tpea bound closed mthk-a88f mutant in nanodisc 0.8942 26 105
3rbz-assembly1.cif.gz_C-2 mthk channel, ca2+-bound 0.8749 30 93
ID Description Score Start End Superfamily
af_Q55CU6_305_415_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9021 19 102 1.10.287.70
af_K7L5I6_274_336_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9017 28 87 1.10.287.70
3rbzA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8917 29 92 1.10.287.70
af_J3K003_426_535_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8662 17 105 1.10.287.70
af_M9NEI3_245_476_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.857 49 101 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A0C2BJI4-F1-model_v4 Potassium channel domain-containing protein 0.9914 1 113 GO:0016020
AF-A0A4Q7VZY1-F1-model_v4 Two pore domain potassium channel family protein 0.9885 1 113 GO:0016020
AF-A0A7W8HHS6-F1-model_v4 Two pore domain potassium channel family protein 0.9859 18 110 GO:0016020
AF-A0A1H3JDU0-F1-model_v4 Two pore domain potassium channel family protein 0.9858 1 113 GO:0016020
AF-A0A4Q3VIA0-F1-model_v4 Two pore domain potassium channel family protein 0.9823 12 109 GO:0016020

Map