F296541

General Info

Members Datasets Scaffolds Average Seq Length
193 115 386 399

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10251261|rootL2_102512613
Length 427
Sequence MSMTSQVMSNGVLTFPIIQDTQTMKTKFYLLSIVALLLVAQIETRAQGCVAVRAMGGTNPLSSDGYWLQKGEFTVGTSYRYFHSFRHFVGKDEKPFRQTTQGGFNADGTQRGNAVNIYSHSIDLNISYAISNRIQFNVSIPYVHNERNQVLRIKTGEKVIIDDREVDQVLVGRRYSVYAKGLGDIRLSTNYWIFDQATAQKGNLMVGLGLKLNTGSHNEKDDAIKLDAEGNVVKETQVMDQAIQPGDGGIGFSVELQGFRQLYKGVYGFASGYYLFNPKESNGSFKSAPKAGLEGYNIYACPDQYLARVGVMGSVLNSKALTLSLAGRWEGIPAYDAFGGQVAYRRPGYVVAVESGVSYRHKKHTLGLFIPYNVVRDRIQSAADIADQNLQNSKIADASKKVHVQGDAAFADYSMNVNYTYRLGKLF

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
100 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
101 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
102 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
103 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
104 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
105 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
108 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
112 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
113 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
114 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
115 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.7
Nodule 0
Rhizoplane 0
Rhizosphere 80.31
Stem 0
Stem Tuber 0
Unclassified 15.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10251261 3300003322 Bacteria 3515
2 JGI25406J46586_10022161 3300003203 Unclassified 2537
3 rootH1_10037833 3300003316 Bacteria 33254
4 rootH2_10052345 3300003320 Bacteria 10683
5 rootH2_10104990 3300003320 Bacteria 3008
6 rootH2_10118836 3300003320 Bacteria 2210
7 rootH2_10336209 3300003320 Unclassified 1449
8 rootL2_10037862 3300003322 Bacteria 5180
9 rootL2_10097507 3300003322 Bacteria 6512
10 rootL2_10099916 3300003322 Bacteria 2041
11 rootL2_10139371 3300003322 Bacteria 2168
12 rootL2_10291863 3300003322 Bacteria 2232
13 rootH1_10060952 3300003323 Bacteria 26024
14 rootH1_10066793 3300003323 Bacteria 2933
15 rootH1_10069210 3300003323 Bacteria 5247
16 rootH1_10098239 3300003323 Bacteria 2206
17 rootH1_10187337 3300003323 Bacteria 5305
18 Ga0065714_10080439 3300005288 Bacteria 2425
19 Ga0070670_100024231 3300005331 Bacteria 5220
20 Ga0070670_100039614 3300005331 Bacteria 4052
21 Ga0070677_10020209 3300005333 Bacteria 2423
22 Ga0068869_100015579 3300005334 Bacteria 5105
23 Ga0068869_100068504 3300005334 Unclassified 2621
24 Ga0068869_100162556 3300005334 Bacteria 1739
25 Ga0070666_10000050 3300005335 Bacteria 100280
26 Ga0070666_10005046 3300005335 Bacteria 8074
27 Ga0068868_100005340 3300005338 Bacteria 9020
28 Ga0068868_100012088 3300005338 Bacteria 6304
29 Ga0070668_100079253 3300005347 Unclassified 2571
30 Ga0070668_100105120 3300005347 Unclassified 2242
31 Ga0070674_100034724 3300005356 Unclassified 3371
32 Ga0070673_100122271 3300005364 Bacteria 2173
33 Ga0070667_100043098 3300005367 Bacteria 3787
34 Ga0070667_100157961 3300005367 Unclassified 1995
35 Ga0070678_100013581 3300005456 Bacteria 5113
36 Ga0070662_100236895 3300005457 Bacteria 1462
37 Ga0068867_100053309 3300005459 Bacteria 2987
38 Ga0068867_100077889 3300005459 Bacteria 2492
39 Ga0068867_100168630 3300005459 Bacteria 1732
40 Ga0070698_100003063 3300005471 Bacteria 18436
41 Ga0070672_100069018 3300005543 Bacteria 2805
42 Ga0068857_100105835 3300005577 Bacteria 2526
43 Ga0068856_100047098 3300005614 Bacteria 4247
44 Ga0068852_100020291 3300005616 Bacteria 5283
45 Ga0068859_100000025 3300005617 Bacteria 191679
46 Ga0068859_100025612 3300005617 Bacteria 5917
47 Ga0068859_100032587 3300005617 Bacteria 5234
48 Ga0068859_100067281 3300005617 Bacteria 3617
49 Ga0068859_100070254 3300005617 Bacteria 3537
50 Ga0068859_100088060 3300005617 Bacteria 3154
51 Ga0068864_100006903 3300005618 Bacteria 9309
52 Ga0068864_100111102 3300005618 Bacteria 2442
53 Ga0068864_100242499 3300005618 Bacteria 1670
54 Ga0068851_10000113 3300005834 Bacteria 42861
55 Ga0068851_10008554 3300005834 Unclassified 4735
56 Ga0068863_100009689 3300005841 Bacteria 9399
57 Ga0068863_100016345 3300005841 Bacteria 7119
58 Ga0068858_100007839 3300005842 Bacteria 10303
59 Ga0068860_100000061 3300005843 Bacteria 192548
60 Ga0068860_100003705 3300005843 Bacteria 15722
61 Ga0068860_100004130 3300005843 Bacteria 14878
62 Ga0068860_100094538 3300005843 Bacteria 2849
63 Ga0068862_100014299 3300005844 Bacteria 6584
64 Ga0081539_10003031 3300005985 Bacteria 21772
65 Ga0075366_10000467 3300006195 Bacteria 18777
66 Ga0097621_100003375 3300006237 Bacteria 10990
67 Ga0097621_100017205 3300006237 Bacteria 5487
68 Ga0097621_100157504 3300006237 Unclassified 1950
69 Ga0068871_100005284 3300006358 Bacteria 9040
70 Ga0068871_100010670 3300006358 Bacteria 6717
71 Ga0068871_100021989 3300006358 Unclassified 4913
72 Ga0068871_100026108 3300006358 Bacteria 4554
73 Ga0068871_100316557 3300006358 Bacteria 1373
74 Ga0097620_100000025 3300006931 Bacteria 191679
75 Ga0097620_100025612 3300006931 Bacteria 5917
76 Ga0097620_100032588 3300006931 Bacteria 5234
77 Ga0097620_100067280 3300006931 Bacteria 3617
78 Ga0097620_100070253 3300006931 Bacteria 3537
79 Ga0097620_100088061 3300006931 Bacteria 3154
80 Ga0105245_10118069 3300009098 Unclassified 2475
81 Ga0105247_10001380 3300009101 Bacteria 17607
82 Ga0105243_10021225 3300009148 Bacteria 4928
83 Ga0105241_10000761 3300009174 Bacteria 24490
84 Ga0105242_10048285 3300009176 Bacteria 3460
85 Ga0105242_10060215 3300009176 Bacteria 3118
86 Ga0105242_10119623 3300009176 Bacteria 2258
87 Ga0105237_10061841 3300009545 Unclassified 3743
88 Ga0105249_10164351 3300009553 Bacteria 2148
89 Ga0105249_10195045 3300009553 Unclassified 1979
90 Ga0105249_10208167 3300009553 Bacteria 1918
91 Ga0105239_10074274 3300010375 Unclassified 3739
92 Ga0105246_10127568 3300011119 Unclassified 1895
93 Ga0157370_10117308 3300013104 Unclassified 2486
94 Ga0157374_10034609 3300013296 Bacteria 4616
95 Ga0157378_10015277 3300013297 Bacteria 6724
96 Ga0157378_10057412 3300013297 Bacteria 3469
97 Ga0157378_10073638 3300013297 Bacteria 3071
98 Ga0163162_10000549 3300013306 Bacteria 34654
99 Ga0163162_10003819 3300013306 Bacteria 14443
100 Ga0163162_10055226 3300013306 Bacteria 3997
101 Ga0163162_10174158 3300013306 Bacteria 2277
102 Ga0157372_10280657 3300013307 Bacteria 1937
103 Ga0157375_10532830 3300013308 Unclassified 1337
104 Ga0157380_10000073 3300014326 Bacteria 56284
105 Ga0157379_10065388 3300014968 Bacteria 3250
106 Ga0157376_10109090 3300014969 Unclassified 2433
107 Ga0157376_10220364 3300014969 Bacteria 1757
108 Ga0209050_1012382 3300025298 Bacteria 3919
109 Ga0209050_1014102 3300025298 Bacteria 3476
110 Ga0209257_1013079 3300025304 Bacteria 3740
111 Ga0207656_10001403 3300025321 Bacteria 7961
112 Ga0207656_10018119 3300025321 Unclassified 2767
113 Ga0207642_10002442 3300025899 Bacteria 5784
114 Ga0207710_10013669 3300025900 Unclassified 3415
115 Ga0207688_10004663 3300025901 Bacteria 7470
116 Ga0207645_10001491 3300025907 Bacteria 19131
117 Ga0207654_10001259 3300025911 Bacteria 13484
118 Ga0207671_10004604 3300025914 Bacteria 13095
119 Ga0207650_10030387 3300025925 Bacteria 3891
120 Ga0207650_10092454 3300025925 Bacteria 2314
121 Ga0207650_10092626 3300025925 Bacteria 2312
122 Ga0207650_10105011 3300025925 Unclassified 2180
123 Ga0207669_10044843 3300025937 Unclassified 2602
124 Ga0207691_10009018 3300025940 Bacteria 9565
125 Ga0207691_10053102 3300025940 Bacteria 3701
126 Ga0207689_10002462 3300025942 Bacteria 17250
127 Ga0207689_10005117 3300025942 Bacteria 11790
128 Ga0207689_10023163 3300025942 Bacteria 5214
129 Ga0207689_10025756 3300025942 Bacteria 4928
130 Ga0207689_10115488 3300025942 Bacteria 2207
131 Ga0207668_10019504 3300025972 Bacteria 4289
132 Ga0207677_10019081 3300026023 Bacteria 4132
133 Ga0207703_10001555 3300026035 Bacteria 20808
134 Ga0207641_10000822 3300026088 Bacteria 32995
135 Ga0207641_10005620 3300026088 Bacteria 10681
136 Ga0207641_10021705 3300026088 Bacteria 5277
137 Ga0207648_10005953 3300026089 Bacteria 12201
138 Ga0207648_10006750 3300026089 Bacteria 11382
139 Ga0207648_10027988 3300026089 Bacteria 5001
140 Ga0207648_10243091 3300026089 Bacteria 1603
141 Ga0207676_10023203 3300026095 Bacteria 4573
142 Ga0207676_10056380 3300026095 Bacteria 3089
143 Ga0207674_10034726 3300026116 Bacteria 5268
144 Ga0207675_100003900 3300026118 Bacteria 14503
145 Ga0207683_10020939 3300026121 Bacteria 5597
146 Ga0207698_10025762 3300026142 Unclassified 4150
147 Ga0207698_10095743 3300026142 Bacteria 2445
148 Ga0268265_10033848 3300028380 Bacteria 3719
149 Ga0268264_10000079 3300028381 Bacteria 249516
150 Ga0268264_10039304 3300028381 Bacteria 3908
151 Ga0268264_10075335 3300028381 Bacteria 2869
152 Ga0307515_10227397 3300028794 Bacteria 1667
153 Ga0307511_10000554 3300030521 Bacteria 40123
154 Ga0307513_10048179 3300031456 Unclassified 4627
155 Ga0307513_10283714 3300031456 Bacteria 1432
156 Ga0307509_10060375 3300031507 Bacteria 4008
157 Ga0307509_10104302 3300031507 Bacteria 2860
158 Ga0307408_100009803 3300031548 Bacteria 6314
159 Ga0307508_10000636 3300031616 Bacteria 42249
160 Ga0307516_10001823 3300031730 Bacteria 29270
161 Ga0307410_10000176 3300031852 Bacteria 23515
162 Ga0307406_10000012 3300031901 Bacteria 111189
163 Ga0307407_10053997 3300031903 Bacteria 2314
164 Ga0307412_10050520 3300031911 Bacteria 2744
165 Ga0307414_10000001 3300032004 Bacteria 1352954
166 Ga0307414_10012830 3300032004 Bacteria 4971
167 Ga0373935_0150132 3300035692 Bacteria 1581
168 Ga0439466_0001004 3300041411 Bacteria 10864
169 Ga0495638_0000006 3300046460 Bacteria 668846
170 Ga0495580_0140524 3300046472 Bacteria 1674
171 Ga0495610_0048333 3300046512 Bacteria 2089
172 Ga0495625_0165897 3300046660 Bacteria 1477
173 Ga0495657_0124640 3300046675 Bacteria 1620
174 Ga0495672_0045513 3300047320 Bacteria 2625
175 Ga0501222_002403 3300049662 Unclassified 2599
176 Ga0501238_000023 3300049671 Bacteria 28110
177 Ga0501249_000006 3300049679 Bacteria 224148
178 Ga0501257_001155 3300049686 Bacteria 5397
179 Ga0501259_005312 3300049688 Unclassified 2037
180 Ga0501225_0015627 3300049705 Unclassified 2113
181 Ga0501266_001359 3300049763 Bacteria 3122
182 nmdc:mga0k408_6554_c1 3300050493 Bacteria 6202
183 Ga0500641_0000014 3300053096 Bacteria 150696
184 Ga0500641_0061000 3300053096 Unclassified 1570
185 Ga0500604_0002737 3300053151 Unclassified 4792
186 Ga0500616_0000044 3300053153 Bacteria 339611
187 Ga0500622_0000409 3300053156 Bacteria 40793
188 Ga0500622_0001352 3300053156 Bacteria 19844
189 2644373279 2643221667 Bacteria 5627472
190 2857613867 2857613821 Bacteria 4917088
191 2904423793 2904419702 Bacteria 5166287
192 2929154210 2929150217 Bacteria 5462483
193 8056443757 8056440228 Bacteria 4946504
194 rootL2_10251261
195 JGI25406J46586_10022161
196 rootH1_10037833
197 rootH2_10052345
198 rootH2_10104990
199 rootH2_10118836
200 rootH2_10336209
201 rootL2_10037862
202 rootL2_10097507
203 rootL2_10099916
204 rootL2_10139371
205 rootL2_10291863
206 rootH1_10060952
207 rootH1_10066793
208 rootH1_10069210
209 rootH1_10098239
210 rootH1_10187337
211 Ga0065714_10080439
212 Ga0070670_100024231
213 Ga0070670_100039614
214 Ga0070677_10020209
215 Ga0068869_100015579
216 Ga0068869_100068504
217 Ga0068869_100162556
218 Ga0070666_10000050
219 Ga0070666_10005046
220 Ga0068868_100005340
221 Ga0068868_100012088
222 Ga0070668_100079253
223 Ga0070668_100105120
224 Ga0070674_100034724
225 Ga0070673_100122271
226 Ga0070667_100043098
227 Ga0070667_100157961
228 Ga0070678_100013581
229 Ga0070662_100236895
230 Ga0068867_100053309
231 Ga0068867_100077889
232 Ga0068867_100168630
233 Ga0070698_100003063
234 Ga0070672_100069018
235 Ga0068857_100105835
236 Ga0068856_100047098
237 Ga0068852_100020291
238 Ga0068859_100000025
239 Ga0068859_100025612
240 Ga0068859_100032587
241 Ga0068859_100067281
242 Ga0068859_100070254
243 Ga0068859_100088060
244 Ga0068864_100006903
245 Ga0068864_100111102
246 Ga0068864_100242499
247 Ga0068851_10000113
248 Ga0068851_10008554
249 Ga0068863_100009689
250 Ga0068863_100016345
251 Ga0068858_100007839
252 Ga0068860_100000061
253 Ga0068860_100003705
254 Ga0068860_100004130
255 Ga0068860_100094538
256 Ga0068862_100014299
257 Ga0081539_10003031
258 Ga0075366_10000467
259 Ga0097621_100003375
260 Ga0097621_100017205
261 Ga0097621_100157504
262 Ga0068871_100005284
263 Ga0068871_100010670
264 Ga0068871_100021989
265 Ga0068871_100026108
266 Ga0068871_100316557
267 Ga0097620_100000025
268 Ga0097620_100025612
269 Ga0097620_100032588
270 Ga0097620_100067280
271 Ga0097620_100070253
272 Ga0097620_100088061
273 Ga0105245_10118069
274 Ga0105247_10001380
275 Ga0105243_10021225
276 Ga0105241_10000761
277 Ga0105242_10048285
278 Ga0105242_10060215
279 Ga0105242_10119623
280 Ga0105237_10061841
281 Ga0105249_10164351
282 Ga0105249_10195045
283 Ga0105249_10208167
284 Ga0105239_10074274
285 Ga0105246_10127568
286 Ga0157370_10117308
287 Ga0157374_10034609
288 Ga0157378_10015277
289 Ga0157378_10057412
290 Ga0157378_10073638
291 Ga0163162_10000549
292 Ga0163162_10003819
293 Ga0163162_10055226
294 Ga0163162_10174158
295 Ga0157372_10280657
296 Ga0157375_10532830
297 Ga0157380_10000073
298 Ga0157379_10065388
299 Ga0157376_10109090
300 Ga0157376_10220364
301 Ga0209050_1012382
302 Ga0209050_1014102
303 Ga0209257_1013079
304 Ga0207656_10001403
305 Ga0207656_10018119
306 Ga0207642_10002442
307 Ga0207710_10013669
308 Ga0207688_10004663
309 Ga0207645_10001491
310 Ga0207654_10001259
311 Ga0207671_10004604
312 Ga0207650_10030387
313 Ga0207650_10092454
314 Ga0207650_10092626
315 Ga0207650_10105011
316 Ga0207669_10044843
317 Ga0207691_10009018
318 Ga0207691_10053102
319 Ga0207689_10002462
320 Ga0207689_10005117
321 Ga0207689_10023163
322 Ga0207689_10025756
323 Ga0207689_10115488
324 Ga0207668_10019504
325 Ga0207677_10019081
326 Ga0207703_10001555
327 Ga0207641_10000822
328 Ga0207641_10005620
329 Ga0207641_10021705
330 Ga0207648_10005953
331 Ga0207648_10006750
332 Ga0207648_10027988
333 Ga0207648_10243091
334 Ga0207676_10023203
335 Ga0207676_10056380
336 Ga0207674_10034726
337 Ga0207675_100003900
338 Ga0207683_10020939
339 Ga0207698_10025762
340 Ga0207698_10095743
341 Ga0268265_10033848
342 Ga0268264_10000079
343 Ga0268264_10039304
344 Ga0268264_10075335
345 Ga0307515_10227397
346 Ga0307511_10000554
347 Ga0307513_10048179
348 Ga0307513_10283714
349 Ga0307509_10060375
350 Ga0307509_10104302
351 Ga0307408_100009803
352 Ga0307508_10000636
353 Ga0307516_10001823
354 Ga0307410_10000176
355 Ga0307406_10000012
356 Ga0307407_10053997
357 Ga0307412_10050520
358 Ga0307414_10000001
359 Ga0307414_10012830
360 Ga0373935_0150132
361 Ga0439466_0001004
362 Ga0495638_0000006
363 Ga0495580_0140524
364 Ga0495610_0048333
365 Ga0495625_0165897
366 Ga0495657_0124640
367 Ga0495672_0045513
368 Ga0501222_002403
369 Ga0501238_000023
370 Ga0501249_000006
371 Ga0501257_001155
372 Ga0501259_005312
373 Ga0501225_0015627
374 Ga0501266_001359
375 nmdc:mga0k408_6554_c1
376 Ga0500641_0000014
377 Ga0500641_0061000
378 Ga0500604_0002737
379 Ga0500616_0000044
380 Ga0500622_0000409
381 Ga0500622_0001352
382 2644373279
383 2857613867
384 2904423793
385 2929154210
386 8056443757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fqe-assembly1.cif.gz_A kdgm porin 0.7806 55 393
4fqe-assembly1.cif.gz_A kdgm porin 0.7605 55 393
5o68-assembly3.cif.gz_I crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7587 50 393
5o68-assembly1.cif.gz_C crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7564 45 393
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7486 45 393
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7806 55 393 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7605 55 393 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6633 56 393 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6552 56 393 2.40.160.40
2wjrA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.59 56 393 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A537KKW7-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8681 202 393
AF-A0A7J5U0N2-F1-model_v4 Outer membrane beta-barrel protein 0.8621 49 395
AF-A0A537KKW7-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8407 202 393
AF-A0A7J5U0N2-F1-model_v4 Outer membrane beta-barrel protein 0.8164 49 395
AF-A0A520WHJ1-F1-model_v4 Transporter 0.8098 92 396

Map