F296446

General Info

Members Datasets Scaffolds Average Seq Length
192 151 384 346

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006486233|3006492920
Length 388
Sequence WVTTPTSRQAGRYTGTLLHMGCKSKQYAKEVGVGAPVVLGIESSCDETGAGIVSGGRLLAHVVASSMDEHARFGGVVPEIAARAHLQAFNPVVQEALDQAGLRLRDLDAVAVTTGPGLSGALQVGLAGAKALAFAAGVPLYGVHHLAGHVAADTLEHGPLPNPCMVLIVSGGHTSLLLVRDLVRDPILHLGDTVDDAAGECFDKVARVFGLPYPGGPAIDRAARTGNPCAVAFPRPLTGPRDDPYAFSFSGLKTAAARWAERHRQSGEGIPVADGAASLQEAVADVLTRKALAACREYGVRTLVVVGGVAANSRVRALAEERCAAAGVELRVPPLTLCTDNGAMIAAVGDLLVRSGSRPAQLDMSVDPSAPLEYAALHPVARPAATVA

Samples

Sample ID Description Type Environment
1 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
5 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
6 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
9 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
10 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
11 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
12 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
13 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
14 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
15 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
24 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
25 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
26 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
27 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
28 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
29 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
30 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
33 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
34 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
39 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
40 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
41 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
42 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
43 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
44 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
45 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
46 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
60 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
61 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
66 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
67 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
71 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
72 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
92 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
93 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
97 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
98 2527291627 Frankia casuarinae Thr Isolate Nodule
99 2527291629 Frankia sp. BMG5.23 Isolate Nodule
100 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
101 2576861822 Frankia sp. CeD Isolate Nodule
102 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
103 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
104 2619618881 Frankia sp. ACN1ag Isolate Unclassified
105 2619619003 Frankia sp. CpI1-P Isolate Nodule
106 2626541554 Frankia sp. AvcI.1 Isolate Nodule
107 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
108 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
109 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
110 2684623036 Frankia sp. CgIM4 Isolate Nodule
111 2710264753 Frankia sp. KB5 Isolate Nodule
112 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
113 2773857924 Frankia sp. CgIS1 Isolate Nodule
114 2773857933 Frankia sp. BMG5.30 Isolate Nodule
115 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
116 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
117 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
118 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
119 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
120 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
121 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
122 2867369537 Streptomyces sp. Z26 Isolate Unclassified
123 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
124 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
125 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
126 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
127 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
128 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
129 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
130 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
131 2891562705 Microbispora tritici MT50 Isolate Unclassified
132 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
133 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
134 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
135 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
136 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
137 637000116 Frankia casuarinae CcI3 Isolate Nodule
138 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
139 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
140 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
141 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
142 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
143 8054920844 Frankia tisae Agncl-8 Isolate Nodule
144 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
145 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
146 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
147 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
148 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
149 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
150 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
151 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.31
Metatranscriptomes 0.52
Isolates 29.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 6.77
Rhizoplane 8.85
Rhizosphere 60.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_101030 3300003285 Bacteria 2690
2 JGI25160J50197_1002040 3300003354 Bacteria 9624
3 JGI25160J50197_1006947 3300003354 Bacteria 4502
4 Ga0055540_1005441 3300003792 Bacteria 5349
5 Ga0055540_1009889 3300003792 Bacteria 3232
6 Ga0070698_100197634 3300005471 Bacteria 1947
7 Ga0068852_100279430 3300005616 Bacteria 1609
8 Ga0068864_100007577 3300005618 Bacteria 8946
9 Ga0081455_10000106 3300005937 Bacteria 93286
10 Ga0070712_100037238 3300006175 Bacteria 3315
11 Ga0105247_10000336 3300009101 Bacteria 41065
12 Ga0105248_10085171 3300009177 Bacteria 3556
13 Ga0105248_10125676 3300009177 Bacteria 2894
14 Ga0105249_10056309 3300009553 Bacteria 3599
15 Ga0157375_10295873 3300013308 Bacteria 1782
16 Ga0157375_10304147 3300013308 Bacteria 1758
17 Ga0163163_10204179 3300014325 Bacteria 2025
18 Ga0157379_10090681 3300014968 Bacteria 2742
19 Ga0157376_10089039 3300014969 Bacteria 2668
20 Ga0207426_1000499 3300025302 Bacteria 58455
21 Ga0207426_1000954 3300025302 Bacteria 28530
22 Ga0207426_1001725 3300025302 Bacteria 16737
23 Ga0209051_1000439 3300025303 Bacteria 56420
24 Ga0209051_1001919 3300025303 Bacteria 16132
25 Ga0207710_10000109 3300025900 Bacteria 104351
26 Ga0207711_10015729 3300025941 Bacteria 6276
27 Ga0207711_10031488 3300025941 Bacteria 4478
28 Ga0207678_10092435 3300026067 Bacteria 2586
29 Ga0207641_10081919 3300026088 Bacteria 2803
30 Ga0207683_10137624 3300026121 Bacteria 2199
31 Ga0265338_10043340 3300028800 Bacteria 4175
32 Ga0316176_1210957 3300030732 Bacteria 3205
33 Ga0314311_1060393 3300030733 Bacteria 2919
34 Ga0316180_1035062 3300030736 Bacteria 2734
35 Ga0265320_10031171 3300031240 Bacteria 2741
36 Ga0265325_10001514 3300031241 Bacteria 16341
37 Ga0265325_10027439 3300031241 Bacteria 3078
38 Ga0265340_10000928 3300031247 Bacteria 16665
39 Ga0265339_10006895 3300031249 Bacteria 7405
40 Ga0265316_10014581 3300031344 Bacteria 6911
41 Ga0316575_10000130 3300031665 Bacteria 18805
42 Ga0265314_10011055 3300031711 Bacteria 7483
43 Ga0265342_10037671 3300031712 Bacteria 2948
44 Ga0307410_10108313 3300031852 Bacteria 2006
45 Ga0307409_100273678 3300031995 Bacteria 1556
46 Ga0307416_100052202 3300032002 Bacteria 3272
47 Ga0307507_10094688 3300033179 Bacteria 2537
48 Ga0400485_08169 3300038735 Bacteria 55719
49 Ga0400488_31055 3300038741 Bacteria 6280
50 Ga0400486_03564 3300038742 Bacteria 38786
51 Ga0400486_16175 3300038742 Bacteria 1627
52 Ga0400483_025481 3300039062 Bacteria 19876
53 Ga0400483_069728 3300039062 Bacteria 2950
54 Ga0400483_250410 3300039062 Bacteria 4435
55 Ga0439465_0031656 3300041413 Bacteria 1686
56 Ga0451789_1154944 3300041443 Bacteria 1414
57 Ga0451793_0039345 3300041452 Bacteria 4160
58 Ga0451833_0568123 3300041491 Bacteria 6723
59 Ga0451837_0010635 3300041494 Bacteria 4056
60 Ga0439445_0040884 3300042004 Bacteria 1231
61 Ga0466961_0045872 3300044693 Bacteria 2796
62 Ga0466963_0063730 3300044694 Bacteria 2468
63 Ga0466963_0111053 3300044694 Bacteria 1882
64 Ga0466964_0064348 3300044706 Bacteria 1534
65 Ga0466957_0063349 3300044842 Bacteria 2273
66 Ga0466957_0143363 3300044842 Bacteria 1541
67 Ga0466957_0178016 3300044842 Bacteria 1388
68 Ga0451576_0062966 3300045051 Bacteria 3867
69 Ga0466958_0067997 3300045836 Bacteria 2177
70 Ga0466967_0005958 3300045976 Bacteria 8557
71 Ga0466967_0008201 3300045976 Bacteria 7629
72 Ga0466967_0042005 3300045976 Bacteria 3948
73 Ga0466967_0190740 3300045976 Bacteria 1937
74 Ga0495629_0032977 3300046459 Bacteria 3665
75 Ga0495584_0159780 3300046491 Bacteria 1145
76 Ga0495608_0040120 3300046511 Bacteria 3137
77 Ga0495635_0118001 3300046663 Bacteria 1811
78 Ga0495600_0108623 3300046809 Bacteria 1807
79 Ga0496100_0310881 3300048903 Bacteria 1182
80 Ga0496102_0451486 3300048905 Bacteria 1206
81 Ga0496104_0005357 3300048907 Bacteria 11229
82 Ga0496105_0001152 3300048908 Bacteria 18424
83 Ga0496105_0063441 3300048908 Bacteria 3048
84 Ga0496108_0004396 3300048911 Bacteria 11346
85 Ga0496108_0072343 3300048911 Bacteria 2910
86 Ga0496109_0081979 3300048912 Bacteria 2972
87 Ga0496110_0005335 3300048913 Bacteria 10067
88 Ga0496113_0042355 3300048916 Bacteria 3364
89 Ga0496113_0159751 3300048916 Bacteria 1781
90 Ga0496114_0002330 3300048917 Bacteria 14456
91 Ga0496114_0092016 3300048917 Bacteria 2576
92 Ga0496114_0178624 3300048917 Bacteria 1853
93 Ga0496117_0000387 3300048920 Bacteria 75589
94 Ga0496120_0000203 3300048923 Bacteria 101935
95 Ga0496122_0002341 3300048925 Bacteria 27352
96 Ga0496126_0000246 3300048929 Bacteria 116854
97 Ga0501032_0005410 3300049569 Bacteria 9497
98 Ga0501032_0254264 3300049569 Bacteria 1140
99 Ga0501034_0003120 3300049571 Bacteria 19088
100 Ga0501034_0012406 3300049571 Bacteria 8801
101 Ga0501034_0043749 3300049571 Bacteria 4530
102 Ga0501036_0009351 3300049572 Bacteria 8060
103 Ga0501036_0124797 3300049572 Bacteria 2174
104 Ga0501037_0056540 3300049573 Bacteria 2865
105 Ga0501037_0125931 3300049573 Bacteria 1839
106 Ga0501038_0037658 3300049574 Bacteria 4240
107 Ga0501038_0074825 3300049574 Bacteria 2864
108 Ga0501043_0018978 3300049579 Bacteria 5397
109 Ga0501043_0032818 3300049579 Bacteria 4083
110 Ga0501047_0400196 3300049581 Bacteria 1206
111 Ga0501048_0010515 3300049582 Bacteria 6907
112 Ga0501070_0005084 3300049586 Bacteria 11212
113 Ga0501070_0005226 3300049586 Bacteria 11067
114 Ga0501070_0035405 3300049586 Bacteria 4171
115 Ga0501070_0064093 3300049586 Bacteria 3044
116 Ga0501072_0053760 3300049588 Bacteria 3172
117 Ga0501073_0027355 3300049589 Bacteria 4078
118 Ga0501073_0208550 3300049589 Bacteria 1350
119 Ga0501074_0002496 3300049590 Bacteria 12819
120 Ga0501074_0039837 3300049590 Bacteria 3402
121 Ga0501075_0305734 3300049591 Bacteria 1212
122 Ga0501079_0001402 3300049741 Bacteria 16984
123 Ga0501080_0012108 3300049742 Bacteria 7902
124 Ga0501080_0014545 3300049742 Bacteria 7248
125 Ga0501080_0022311 3300049742 Bacteria 5864
126 Ga0501080_0151530 3300049742 Bacteria 2143
127 Ga0501044_0011287 3300049823 Bacteria 9682
128 Ga0501044_0092357 3300049823 Bacteria 3052
129 Ga0501044_0378100 3300049823 Bacteria 1332
130 nmdc:mga00v17_142861_c1 3300050491 Bacteria 1535
131 Ga0500616_0000027 3300053153 Bacteria 441053
132 Ga0500645_009610 3300053730 Bacteria 3241
133 Ga0590075_004674 3300059424 Bacteria 3240
134 Ga0501082_0047733 3300060353 Bacteria 3690
135 Ga0466962_0010782 3300061719 Bacteria 4392
136 Ga0530510_0154408 3300061734 Bacteria 1696
137 3006492920 3006486233 Bacteria 8157040
138 2528203968 2527291627 Bacteria 5309833
139 2528214094 2527291629 Bacteria 5267418
140 2546949477 2546825537 Bacteria 5389291
141 2579749206 2576861822 Bacteria 5004595
142 2579854616 2579778521 Bacteria 7624758
143 2616905170 2616644941 Bacteria 8510691
144 2619856713 2619618881 Bacteria 7521104
145 2620349237 2619619003 Bacteria 7619552
146 2626636410 2626541554 Bacteria 7741902
147 2644489973 2643221687 Bacteria 6500351
148 2644538452 2643221697 Bacteria 3575694
149 2676494511 2675903060 Bacteria 10051191
150 2686544554 2684623036 Bacteria 5199090
151 2710603349 2710264753 Bacteria 5455564
152 2768647316 2767802112 Bacteria 6465194
153 2774865398 2773857924 Bacteria 5256821
154 2774902863 2773857933 Bacteria 5818019
155 2804846102 2802429296 Bacteria 7227771
156 2812364414 2811994880 Bacteria 4147780
157 2844854359 2844852863 Bacteria 3849151
158 2848552812 2848551377 Bacteria 3720646
159 2856746577 2856741275 Bacteria 8096094
160 2857734505 2857733635 Bacteria 3532004
161 2862183455 2862178590 Bacteria 8583590
162 2867369907 2867369537 Bacteria 6501581
163 2867372176 2867369537 Bacteria 6501581
164 2873153489 2873151551 Bacteria 8625867
165 2873322089 2873314349 Bacteria 8512634
166 2875391916 2875391855 Bacteria 7600475
167 2877682166 2877676314 Bacteria 9512378
168 2884694869 2884693830 Bacteria 11273186
169 2887446099 2887443736 Bacteria 4426037
170 2891401865 2891395885 Bacteria 9251614
171 2891560605 2891554331 Bacteria 8812224
172 2891566147 2891562705 Bacteria 8039471
173 2895432653 2895427314 Bacteria 13147766
174 2895446436 2895442618 Bacteria 11027144
175 2902841598 2902837492 Bacteria 6697721
176 2918508853 2918501144 Bacteria 8668083
177 2935396737 2935390628 Bacteria 7043367
178 637879987 637000116 Bacteria 5433628
179 8025415698 8025413630 Bacteria 7014048
180 8025481562 8025478263 Bacteria 8209203
181 8053950994 8053945823 Bacteria 8962862
182 8054164571 8054160619 Bacteria 7783213
183 8054913887 8054913762 Bacteria 7713009
184 8054924989 8054920844 Bacteria 7068637
185 8055073958 8055066027 Bacteria 9479577
186 8055159147 8055157932 Bacteria 6429399
187 8055179004 8055172936 Bacteria 9305943
188 8056039345 8056037122 Bacteria 3854319
189 8056448238 8056447290 Bacteria 7680491
190 8056668875 8056667051 Bacteria 6953971
191 8057347442 8057345674 Bacteria 4160394
192 8057574935 8057568493 Bacteria 7221719
193 Ga0007423J48922_101030
194 JGI25160J50197_1002040
195 JGI25160J50197_1006947
196 Ga0055540_1005441
197 Ga0055540_1009889
198 Ga0070698_100197634
199 Ga0068852_100279430
200 Ga0068864_100007577
201 Ga0081455_10000106
202 Ga0070712_100037238
203 Ga0105247_10000336
204 Ga0105248_10085171
205 Ga0105248_10125676
206 Ga0105249_10056309
207 Ga0157375_10295873
208 Ga0157375_10304147
209 Ga0163163_10204179
210 Ga0157379_10090681
211 Ga0157376_10089039
212 Ga0207426_1000499
213 Ga0207426_1000954
214 Ga0207426_1001725
215 Ga0209051_1000439
216 Ga0209051_1001919
217 Ga0207710_10000109
218 Ga0207711_10015729
219 Ga0207711_10031488
220 Ga0207678_10092435
221 Ga0207641_10081919
222 Ga0207683_10137624
223 Ga0265338_10043340
224 Ga0316176_1210957
225 Ga0314311_1060393
226 Ga0316180_1035062
227 Ga0265320_10031171
228 Ga0265325_10001514
229 Ga0265325_10027439
230 Ga0265340_10000928
231 Ga0265339_10006895
232 Ga0265316_10014581
233 Ga0316575_10000130
234 Ga0265314_10011055
235 Ga0265342_10037671
236 Ga0307410_10108313
237 Ga0307409_100273678
238 Ga0307416_100052202
239 Ga0307507_10094688
240 Ga0400485_08169
241 Ga0400488_31055
242 Ga0400486_03564
243 Ga0400486_16175
244 Ga0400483_025481
245 Ga0400483_069728
246 Ga0400483_250410
247 Ga0439465_0031656
248 Ga0451789_1154944
249 Ga0451793_0039345
250 Ga0451833_0568123
251 Ga0451837_0010635
252 Ga0439445_0040884
253 Ga0466961_0045872
254 Ga0466963_0063730
255 Ga0466963_0111053
256 Ga0466964_0064348
257 Ga0466957_0063349
258 Ga0466957_0143363
259 Ga0466957_0178016
260 Ga0451576_0062966
261 Ga0466958_0067997
262 Ga0466967_0005958
263 Ga0466967_0008201
264 Ga0466967_0042005
265 Ga0466967_0190740
266 Ga0495629_0032977
267 Ga0495584_0159780
268 Ga0495608_0040120
269 Ga0495635_0118001
270 Ga0495600_0108623
271 Ga0496100_0310881
272 Ga0496102_0451486
273 Ga0496104_0005357
274 Ga0496105_0001152
275 Ga0496105_0063441
276 Ga0496108_0004396
277 Ga0496108_0072343
278 Ga0496109_0081979
279 Ga0496110_0005335
280 Ga0496113_0042355
281 Ga0496113_0159751
282 Ga0496114_0002330
283 Ga0496114_0092016
284 Ga0496114_0178624
285 Ga0496117_0000387
286 Ga0496120_0000203
287 Ga0496122_0002341
288 Ga0496126_0000246
289 Ga0501032_0005410
290 Ga0501032_0254264
291 Ga0501034_0003120
292 Ga0501034_0012406
293 Ga0501034_0043749
294 Ga0501036_0009351
295 Ga0501036_0124797
296 Ga0501037_0056540
297 Ga0501037_0125931
298 Ga0501038_0037658
299 Ga0501038_0074825
300 Ga0501043_0018978
301 Ga0501043_0032818
302 Ga0501047_0400196
303 Ga0501048_0010515
304 Ga0501070_0005084
305 Ga0501070_0005226
306 Ga0501070_0035405
307 Ga0501070_0064093
308 Ga0501072_0053760
309 Ga0501073_0027355
310 Ga0501073_0208550
311 Ga0501074_0002496
312 Ga0501074_0039837
313 Ga0501075_0305734
314 Ga0501079_0001402
315 Ga0501080_0012108
316 Ga0501080_0014545
317 Ga0501080_0022311
318 Ga0501080_0151530
319 Ga0501044_0011287
320 Ga0501044_0092357
321 Ga0501044_0378100
322 nmdc:mga00v17_142861_c1
323 Ga0500616_0000027
324 Ga0500645_009610
325 Ga0590075_004674
326 Ga0501082_0047733
327 Ga0466962_0010782
328 Ga0530510_0154408
329 3006492920
330 2528203968
331 2528214094
332 2546949477
333 2579749206
334 2579854616
335 2616905170
336 2619856713
337 2620349237
338 2626636410
339 2644489973
340 2644538452
341 2676494511
342 2686544554
343 2710603349
344 2768647316
345 2774865398
346 2774902863
347 2804846102
348 2812364414
349 2844854359
350 2848552812
351 2856746577
352 2857734505
353 2862183455
354 2867369907
355 2867372176
356 2873153489
357 2873322089
358 2875391916
359 2877682166
360 2884694869
361 2887446099
362 2891401865
363 2891560605
364 2891566147
365 2895432653
366 2895446436
367 2902841598
368 2918508853
369 2935396737
370 637879987
371 8025415698
372 8025481562
373 8053950994
374 8054164571
375 8054913887
376 8054924989
377 8055073958
378 8055159147
379 8055179004
380 8056039345
381 8056448238
382 8056668875
383 8057347442
384 8057574935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

57

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eno-assembly2.cif.gz_B crystal structure of pyrococcus furiosus pcc1 in complex with thermoplasma acidophilum kae1 0.9522 5 344
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.949 7 343
4ydu-assembly1.cif.gz_A crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp 0.9471 7 346
4wq4-assembly2.cif.gz_B e. coli ygjd(e12a)-yeaz heterodimer in complex with atp 0.9456 7 346
3zeu-assembly2.cif.gz_B structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas 0.9431 7 346
ID Description Score Start End Superfamily
af_A0A1D6MRI9_77_194_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9818 9 124 3.30.420.40
af_Q2FWL2_8_131_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9778 11 131 3.30.420.40
af_P05852_1_106_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9774 7 109 3.30.420.40
af_Q32LQ3_26_143_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9741 7 120 3.30.420.40
af_Q54EW4_18_143_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9709 8 127 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7X8WQW8-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9972 4 119 GO:0008033
GO:0016746
GO:0046872
AF-A0A6L6D3R8-F1-model_v4 deleted 0.9957 4 112
AF-A0A2I1Y8G4-F1-model_v4 deleted 0.995 4 347
AF-A0A7W0PUM5-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9918 7 109 GO:0008033
GO:0016746
GO:0046872
AF-A0A353CCC5-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9915 7 118 GO:0008033
GO:0046872
GO:0061711

Map