F296326

General Info

Members Datasets Scaffolds Average Seq Length
192 142 384 143

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_1965_c1|nmdc:mga08y16_1965_c1_9664_10167
Length 167
Sequence MASMTAAQKRAQAKVDYDAFLAGCPSRQLLARISDKWVALVLAALGSGGPQPAEECVDEPRPMRYSELSRRLAGVSQKMLTQTLRSLERDGLLTRTVTPTVPVTVTYELTDLGSSLHDIMRGIKLWAEAHMDEVLANREEYDVAQRSVVPAASTQPAPGGRARSLGR

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
60 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
71 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
72 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
73 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
74 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
79 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
119 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
120 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
121 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
122 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2501939600 Micromonospora sp. L5 Isolate Unclassified
126 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
127 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
128 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
129 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
130 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
131 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
132 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
133 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
134 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
135 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
136 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
137 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
138 649633069 Micromonospora sp. L5 Isolate Unclassified
139 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
140 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
141 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
142 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.06
Metatranscriptomes 1.56
Isolates 9.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 0
Rhizoplane 2.08
Rhizosphere 80.73
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_1965_c1 3300050511 Bacteria 20967
2 JGI25407J50210_10000149 3300003373 Bacteria 10846
3 JGI25405J52794_10059476 3300003911 Bacteria 825
4 Ga0070683_100022966 3300005329 Bacteria 5577
5 Ga0070670_100502054 3300005331 Unclassified 1079
6 Ga0070668_100990468 3300005347 Bacteria 755
7 Ga0070669_100424611 3300005353 Bacteria 1091
8 Ga0070674_100477607 3300005356 Bacteria 1034
9 Ga0070688_100154164 3300005365 Bacteria 1573
10 Ga0070681_10286364 3300005458 Bacteria 1558
11 Ga0068859_100600144 3300005617 Bacteria 1194
12 Ga0068864_101160112 3300005618 Bacteria 770
13 Ga0068861_100293890 3300005719 Bacteria 1404
14 Ga0068861_100952748 3300005719 Bacteria 816
15 Ga0068863_100156420 3300005841 Bacteria 2183
16 Ga0068858_101972730 3300005842 Bacteria 577
17 Ga0068862_101138243 3300005844 Bacteria 777
18 Ga0081455_10011292 3300005937 Bacteria 8986
19 Ga0081455_10029323 3300005937 Bacteria 5017
20 Ga0081455_10039118 3300005937 Bacteria 4195
21 Ga0081455_10066350 3300005937 Bacteria 3014
22 Ga0081455_10293412 3300005937 Bacteria 1170
23 Ga0081538_10000633 3300005981 Bacteria 38961
24 Ga0081538_10032029 3300005981 Bacteria 3533
25 Ga0081538_10039222 3300005981 Bacteria 3041
26 Ga0081538_10056846 3300005981 Bacteria 2288
27 Ga0081538_10116588 3300005981 Bacteria 1295
28 Ga0070717_10393680 3300006028 Bacteria 1244
29 Ga0075365_10019412 3300006038 Bacteria 4195
30 Ga0075363_100205943 3300006048 Bacteria 1125
31 Ga0075363_100840152 3300006048 Bacteria 560
32 Ga0075364_10140660 3300006051 Bacteria 1623
33 Ga0075364_10279062 3300006051 Bacteria 1137
34 Ga0075364_10713339 3300006051 Unclassified 684
35 Ga0075367_10205423 3300006178 Bacteria 1231
36 Ga0075369_10029156 3300006186 Bacteria 2317
37 Ga0075427_10093460 3300006194 Bacteria 554
38 Ga0075370_10007280 3300006353 Bacteria 5633
39 Ga0075370_10867924 3300006353 Bacteria 551
40 Ga0075428_100063198 3300006844 Bacteria 4053
41 Ga0075428_100653220 3300006844 Bacteria 1121
42 Ga0075430_100158896 3300006846 Bacteria 1882
43 Ga0075431_100009110 3300006847 Bacteria 9955
44 Ga0075431_100113177 3300006847 Bacteria 2801
45 Ga0075431_100228898 3300006847 Bacteria 1894
46 Ga0075429_100061035 3300006880 Bacteria 3284
47 Ga0075429_100116654 3300006880 Bacteria 2334
48 Ga0075429_100248239 3300006880 Bacteria 1558
49 Ga0097620_100600137 3300006931 Bacteria 1194
50 Ga0105250_10098027 3300009092 Bacteria 1195
51 Ga0111539_10059760 3300009094 Bacteria 4519
52 Ga0111539_10257736 3300009094 Bacteria 2031
53 Ga0105245_12388747 3300009098 Bacteria 582
54 Ga0114129_10057894 3300009147 Bacteria 5422
55 Ga0114129_10130185 3300009147 Bacteria 3457
56 Ga0114129_11082165 3300009147 Bacteria 1005
57 Ga0114129_11111540 3300009147 Bacteria 989
58 Ga0105242_10424544 3300009176 Bacteria 1247
59 Ga0105249_11429115 3300009553 Bacteria 764
60 Ga0105249_11824189 3300009553 Bacteria 681
61 Ga0105033_102401 3300009986 Bacteria 1551
62 Ga0157369_10035883 3300013105 Bacteria 5435
63 Ga0163162_10157982 3300013306 Bacteria 2388
64 Ga0163163_11075531 3300014325 Bacteria 867
65 Ga0157380_10293541 3300014326 Unclassified 1494
66 Ga0163161_10041839 3300017792 Bacteria 3293
67 Ga0206354_10488113 3300020081 Bacteria 708
68 Ga0206353_10599807 3300020082 Bacteria 1068
69 Ga0224712_10144648 3300022467 Bacteria 1049
70 Ga0224572_1023999 3300024225 Bacteria 1171
71 Ga0207700_10930979 3300025928 Bacteria 778
72 Ga0207664_10824759 3300025929 Bacteria 834
73 Ga0207644_10491086 3300025931 Bacteria 1012
74 Ga0207686_10874580 3300025934 Bacteria 724
75 Ga0207669_10998041 3300025937 Bacteria 703
76 Ga0207691_10317379 3300025940 Unclassified 1336
77 Ga0207661_10423579 3300025944 Bacteria 1209
78 Ga0207668_10173211 3300025972 Bacteria 1695
79 Ga0207675_100517401 3300026118 Bacteria 1189
80 Ga0207675_100520460 3300026118 Bacteria 1186
81 Ga0207675_101816565 3300026118 Unclassified 629
82 Ga0207683_10090477 3300026121 Bacteria 2725
83 Ga0207428_10442918 3300027907 Bacteria 948
84 Ga0316176_1140092 3300030732 Bacteria 1090
85 Ga0316178_1013814 3300030735 Bacteria 1024
86 Ga0307408_101400251 3300031548 Bacteria 658
87 Ga0307405_10087132 3300031731 Bacteria 2057
88 Ga0307405_10103338 3300031731 Bacteria 1916
89 Ga0307410_10247923 3300031852 Bacteria 1383
90 Ga0307410_11051492 3300031852 Bacteria 704
91 Ga0307406_10643891 3300031901 Bacteria 879
92 Ga0307407_10816175 3300031903 Bacteria 710
93 Ga0307415_100059938 3300032126 Bacteria 2627
94 Ga0307415_101041040 3300032126 Bacteria 763
95 Ga0307415_101650717 3300032126 Bacteria 617
96 Ga0395899_0266392 3300037312 Bacteria 1170
97 Ga0395905_0162177 3300037471 Bacteria 2101
98 Ga0395901_0248476 3300038443 Bacteria 1854
99 Ga0439443_014387 3300042003 Bacteria 1191
100 Ga0439448_0023487 3300042005 Bacteria 1924
101 Ga0439450_000440 3300042008 Bacteria 5396
102 Ga0439454_024850 3300042011 Bacteria 907
103 Ga0439455_0007736 3300042012 Bacteria 2283
104 Ga0439463_012206 3300042016 Bacteria 2110
105 Ga0439444_0007546 3300042437 Bacteria 1674
106 Ga0439464_0007056 3300042439 Bacteria 2936
107 Ga0439460_0004462 3300042461 Bacteria 3410
108 Ga0439440_0025520 3300042993 Bacteria 1361
109 Ga0439440_0029035 3300042993 Bacteria 1294
110 Ga0466961_0543107 3300044693 Bacteria 700
111 Ga0466957_0052824 3300044842 Bacteria 2476
112 Ga0466960_0674533 3300044901 Bacteria 618
113 Ga0466958_0261062 3300045836 Bacteria 1109
114 Ga0466967_0290081 3300045976 Bacteria 1572
115 Ga0466967_1480371 3300045976 Bacteria 676
116 Ga0495674_0308444 3300047319 Bacteria 1292
117 Ga0496101_0694608 3300048904 Bacteria 803
118 Ga0496102_0033667 3300048905 Bacteria 4606
119 Ga0496106_0000210 3300048909 Bacteria 40806
120 Ga0496110_1828231 3300048913 Bacteria 518
121 Ga0496124_0167411 3300048927 Bacteria 1706
122 Ga0496126_0535610 3300048929 Bacteria 931
123 Ga0501031_0116421 3300049568 Bacteria 1746
124 Ga0501031_0656756 3300049568 Bacteria 674
125 Ga0501036_0189861 3300049572 Bacteria 1729
126 Ga0501038_0310710 3300049574 Bacteria 1235
127 Ga0501039_0143151 3300049575 Bacteria 1878
128 Ga0501040_0505936 3300049576 Bacteria 871
129 Ga0501040_0705362 3300049576 Bacteria 730
130 Ga0501041_0062273 3300049577 Bacteria 2284
131 Ga0501042_0023697 3300049578 Bacteria 4298
132 Ga0501046_0904215 3300049580 Bacteria 616
133 Ga0501048_0173712 3300049582 Bacteria 1527
134 Ga0501067_0483499 3300049583 Bacteria 692
135 Ga0501071_0128401 3300049587 Bacteria 1882
136 Ga0501076_0021051 3300049592 Bacteria 4998
137 Ga0501076_0292396 3300049592 Bacteria 1335
138 Ga0501077_0470748 3300049593 Bacteria 805
139 Ga0501080_1692982 3300049742 Bacteria 534
140 Ga0501035_0125527 3300049822 Bacteria 2240
141 Ga0501044_0085907 3300049823 Bacteria 3179
142 Ga0501045_0322303 3300049824 Bacteria 1150
143 nmdc:mga03n38_226157_c1 3300050490 Bacteria 979
144 nmdc:mga03n38_293404_c1 3300050490 Bacteria 871
145 nmdc:mga03n38_745053_c1 3300050490 Bacteria 567
146 nmdc:mga00v17_197797_c1 3300050491 Bacteria 1299
147 nmdc:mga00v17_638122_c1 3300050491 Unclassified 685
148 nmdc:mga0yw44_765566_c1 3300050492 Bacteria 656
149 nmdc:mga05p37_1408000_c1 3300050507 Bacteria 702
150 nmdc:mga05p37_1511783_c1 3300050507 Bacteria 668
151 nmdc:mga05p37_829155_c1 3300050507 Bacteria 1007
152 nmdc:mga09592_1590358_c1 3300050508 Bacteria 530
153 nmdc:mga09592_327199_c1 3300050508 Bacteria 1327
154 nmdc:mga09592_361546_c1 3300050508 Bacteria 1256
155 nmdc:mga0qj67_161629_c1 3300050509 Bacteria 1818
156 nmdc:mga0qj67_243410_c1 3300050509 Bacteria 1459
157 nmdc:mga0qj67_274133_c1 3300050509 Bacteria 1368
158 nmdc:mga0qj67_350489_c1 3300050509 Bacteria 1193
159 nmdc:mga0qj67_448258_c1 3300050509 Bacteria 1040
160 nmdc:mga06r32_304422_c1 3300050510 Bacteria 1580
161 nmdc:mga06r32_385876_c1 3300050510 Bacteria 1383
162 nmdc:mga06r32_393778_c1 3300050510 Bacteria 1368
163 nmdc:mga08y16_1259110_c1 3300050511 Bacteria 708
164 nmdc:mga08y16_336945_c1 3300050511 Bacteria 1551
165 nmdc:mga0a205_416136_c1 3300050515 Bacteria 1206
166 nmdc:mga0sz30_109538_c1 3300050516 Bacteria 1210
167 Ga0500566_0005207 3300053094 Bacteria 7744
168 Ga0500560_098176 3300053107 Bacteria 981
169 Ga0500642_0222108 3300053130 Bacteria 875
170 Ga0500633_0349639 3300053160 Bacteria 538
171 Ga0590077_071349 3300059426 Bacteria 794
172 Ga0501082_0213704 3300060353 Bacteria 1678
173 Ga0501082_0811054 3300060353 Bacteria 819
174 Ga0530510_0171714 3300061734 Bacteria 1606
175 2501942414 2501939600 Bacteria 6907073
176 2515853721 2515154155 Bacteria 7985436
177 2739206169 2738543005 Bacteria 5278128
178 2791914094 2791354901 Bacteria 8322202
179 2837273429 2837268691 Bacteria 7850704
180 2839988561 2839986021 Bacteria 3685650
181 2856859946 2856858025 Bacteria 7255264
182 2862706763 2862705112 Bacteria 6563286
183 2904502013 2904501621 Bacteria 3401437
184 2908677881 2908674828 Bacteria 3382763
185 2928122661 2928121344 Bacteria 3972376
186 2928502453 2928500415 Bacteria 3384541
187 2995464397 2995463766 Bacteria 8577691
188 649810430 649633069 Bacteria 6962533
189 8008489129 8008485437 Bacteria 7198341
190 8025528612 8025524527 Bacteria 7197316
191 8055068154 8055066027 Bacteria 9479577
192 8056057349 8056054917 Bacteria 5736694
193 nmdc:mga08y16_1965_c1
194 JGI25407J50210_10000149
195 JGI25405J52794_10059476
196 Ga0070683_100022966
197 Ga0070670_100502054
198 Ga0070668_100990468
199 Ga0070669_100424611
200 Ga0070674_100477607
201 Ga0070688_100154164
202 Ga0070681_10286364
203 Ga0068859_100600144
204 Ga0068864_101160112
205 Ga0068861_100293890
206 Ga0068861_100952748
207 Ga0068863_100156420
208 Ga0068858_101972730
209 Ga0068862_101138243
210 Ga0081455_10011292
211 Ga0081455_10029323
212 Ga0081455_10039118
213 Ga0081455_10066350
214 Ga0081455_10293412
215 Ga0081538_10000633
216 Ga0081538_10032029
217 Ga0081538_10039222
218 Ga0081538_10056846
219 Ga0081538_10116588
220 Ga0070717_10393680
221 Ga0075365_10019412
222 Ga0075363_100205943
223 Ga0075363_100840152
224 Ga0075364_10140660
225 Ga0075364_10279062
226 Ga0075364_10713339
227 Ga0075367_10205423
228 Ga0075369_10029156
229 Ga0075427_10093460
230 Ga0075370_10007280
231 Ga0075370_10867924
232 Ga0075428_100063198
233 Ga0075428_100653220
234 Ga0075430_100158896
235 Ga0075431_100009110
236 Ga0075431_100113177
237 Ga0075431_100228898
238 Ga0075429_100061035
239 Ga0075429_100116654
240 Ga0075429_100248239
241 Ga0097620_100600137
242 Ga0105250_10098027
243 Ga0111539_10059760
244 Ga0111539_10257736
245 Ga0105245_12388747
246 Ga0114129_10057894
247 Ga0114129_10130185
248 Ga0114129_11082165
249 Ga0114129_11111540
250 Ga0105242_10424544
251 Ga0105249_11429115
252 Ga0105249_11824189
253 Ga0105033_102401
254 Ga0157369_10035883
255 Ga0163162_10157982
256 Ga0163163_11075531
257 Ga0157380_10293541
258 Ga0163161_10041839
259 Ga0206354_10488113
260 Ga0206353_10599807
261 Ga0224712_10144648
262 Ga0224572_1023999
263 Ga0207700_10930979
264 Ga0207664_10824759
265 Ga0207644_10491086
266 Ga0207686_10874580
267 Ga0207669_10998041
268 Ga0207691_10317379
269 Ga0207661_10423579
270 Ga0207668_10173211
271 Ga0207675_100517401
272 Ga0207675_100520460
273 Ga0207675_101816565
274 Ga0207683_10090477
275 Ga0207428_10442918
276 Ga0316176_1140092
277 Ga0316178_1013814
278 Ga0307408_101400251
279 Ga0307405_10087132
280 Ga0307405_10103338
281 Ga0307410_10247923
282 Ga0307410_11051492
283 Ga0307406_10643891
284 Ga0307407_10816175
285 Ga0307415_100059938
286 Ga0307415_101041040
287 Ga0307415_101650717
288 Ga0395899_0266392
289 Ga0395905_0162177
290 Ga0395901_0248476
291 Ga0439443_014387
292 Ga0439448_0023487
293 Ga0439450_000440
294 Ga0439454_024850
295 Ga0439455_0007736
296 Ga0439463_012206
297 Ga0439444_0007546
298 Ga0439464_0007056
299 Ga0439460_0004462
300 Ga0439440_0025520
301 Ga0439440_0029035
302 Ga0466961_0543107
303 Ga0466957_0052824
304 Ga0466960_0674533
305 Ga0466958_0261062
306 Ga0466967_0290081
307 Ga0466967_1480371
308 Ga0495674_0308444
309 Ga0496101_0694608
310 Ga0496102_0033667
311 Ga0496106_0000210
312 Ga0496110_1828231
313 Ga0496124_0167411
314 Ga0496126_0535610
315 Ga0501031_0116421
316 Ga0501031_0656756
317 Ga0501036_0189861
318 Ga0501038_0310710
319 Ga0501039_0143151
320 Ga0501040_0505936
321 Ga0501040_0705362
322 Ga0501041_0062273
323 Ga0501042_0023697
324 Ga0501046_0904215
325 Ga0501048_0173712
326 Ga0501067_0483499
327 Ga0501071_0128401
328 Ga0501076_0021051
329 Ga0501076_0292396
330 Ga0501077_0470748
331 Ga0501080_1692982
332 Ga0501035_0125527
333 Ga0501044_0085907
334 Ga0501045_0322303
335 nmdc:mga03n38_226157_c1
336 nmdc:mga03n38_293404_c1
337 nmdc:mga03n38_745053_c1
338 nmdc:mga00v17_197797_c1
339 nmdc:mga00v17_638122_c1
340 nmdc:mga0yw44_765566_c1
341 nmdc:mga05p37_1408000_c1
342 nmdc:mga05p37_1511783_c1
343 nmdc:mga05p37_829155_c1
344 nmdc:mga09592_1590358_c1
345 nmdc:mga09592_327199_c1
346 nmdc:mga09592_361546_c1
347 nmdc:mga0qj67_161629_c1
348 nmdc:mga0qj67_243410_c1
349 nmdc:mga0qj67_274133_c1
350 nmdc:mga0qj67_350489_c1
351 nmdc:mga0qj67_448258_c1
352 nmdc:mga06r32_304422_c1
353 nmdc:mga06r32_385876_c1
354 nmdc:mga06r32_393778_c1
355 nmdc:mga08y16_1259110_c1
356 nmdc:mga08y16_336945_c1
357 nmdc:mga0a205_416136_c1
358 nmdc:mga0sz30_109538_c1
359 Ga0500566_0005207
360 Ga0500560_098176
361 Ga0500642_0222108
362 Ga0500633_0349639
363 Ga0590077_071349
364 Ga0501082_0213704
365 Ga0501082_0811054
366 Ga0530510_0171714
367 2501942414
368 2515853721
369 2739206169
370 2791914094
371 2837273429
372 2839988561
373 2856859946
374 2862706763
375 2904502013
376 2908677881
377 2928122661
378 2928502453
379 2995464397
380 649810430
381 8008489129
382 8025528612
383 8055068154
384 8056057349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

32

135

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.9161 23 134
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.8941 24 129
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8924 62 111
5hs9-assembly1.cif.gz_B crystal structure of the quinone-bound yodb from b. subtilis 0.891 24 129
6pco-assembly2.cif.gz_C mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid 0.8881 39 129
ID Description Score Start End Superfamily
af_Q4DKK4_1_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8956 40 111 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8941 24 129 1.10.10.10
2fswA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8932 23 128 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8924 62 111 1.10.10.10
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8917 24 129 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A101NZL3-F1-model_v4 deleted 0.9566 39 134
AF-A0A3Q9G021-F1-model_v4 Transcriptional regulator 0.956 39 142 GO:0003677
AF-A0A520EWZ1-F1-model_v4 deleted 0.9559 36 135
AF-A0A1Q4ZP04-F1-model_v4 HxlR family transcriptional regulator 0.9522 28 142 GO:0003677
AF-A0A3N1CWF9-F1-model_v4 HxlR family transcriptional regulator 0.9498 23 146 GO:0003677

Map