F296186

General Info

Members Datasets Scaffolds Average Seq Length
192 122 384 131

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0013598|Ga0495686_0013598_3691_4083
Length 130
Sequence MAGTRKLIEMAYSAFNKRDIDGALALMTQDVSWPKASEGGKVVGKEEIRTYWTRQWSEFDPNVEPLAITEDVDKVYVRVHQLVRTLEGKVLADSEVLHVFTVSTGLIAAMDLGGEADANAGPSAAFAHRS

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 2.08
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0013598 3300047472 Bacteria 5644
2 JGI24740J21852_10145147 3300001979 Bacteria 590
3 rootH2_10269626 3300003320 Unclassified 2298
4 Ga0070658_10741479 3300005327 Bacteria 853
5 Ga0070658_10797648 3300005327 Bacteria 820
6 Ga0070683_100132077 3300005329 Bacteria 2363
7 Ga0070683_100539223 3300005329 Bacteria 1115
8 Ga0070666_10450194 3300005335 Bacteria 930
9 Ga0070680_100006173 3300005336 Bacteria 9085
10 Ga0070711_100226493 3300005439 Bacteria 1456
11 Ga0070711_100548639 3300005439 Bacteria 959
12 Ga0070705_100092066 3300005440 Bacteria 1891
13 Ga0070708_100016798 3300005445 Bacteria 6085
14 Ga0070708_100341186 3300005445 Bacteria 1412
15 Ga0070708_100407753 3300005445 Unclassified 1282
16 Ga0070663_100020707 3300005455 Bacteria 4358
17 Ga0070663_100605171 3300005455 Bacteria 922
18 Ga0070663_101784696 3300005455 Bacteria 551
19 Ga0070681_10028224 3300005458 Bacteria 5642
20 Ga0070681_10037445 3300005458 Bacteria 4867
21 Ga0070706_100408781 3300005467 Bacteria 1264
22 Ga0070707_100097766 3300005468 Bacteria 2843
23 Ga0070698_100450520 3300005471 Bacteria 1223
24 Ga0070699_100957004 3300005518 Bacteria 785
25 Ga0070679_100050474 3300005530 Bacteria 4144
26 Ga0070679_100229538 3300005530 Bacteria 1816
27 Ga0070697_100018668 3300005536 Bacteria 5471
28 Ga0070697_100127663 3300005536 Bacteria 2131
29 Ga0070695_100023606 3300005545 Bacteria 3782
30 Ga0070665_100193341 3300005548 Bacteria 2035
31 Ga0070665_100226386 3300005548 Bacteria 1870
32 Ga0068855_100038565 3300005563 Bacteria 5676
33 Ga0068855_100059046 3300005563 Bacteria 4489
34 Ga0068855_100677583 3300005563 Bacteria 1105
35 Ga0068852_100211473 3300005616 Bacteria 1840
36 Ga0068852_100786605 3300005616 Bacteria 965
37 Ga0068864_102364433 3300005618 Unclassified 538
38 Ga0068858_100354371 3300005842 Bacteria 1406
39 Ga0081540_1006186 3300005983 Bacteria 8776
40 Ga0081540_1006927 3300005983 Bacteria 8169
41 Ga0081540_1032115 3300005983 Bacteria 2872
42 Ga0081540_1044602 3300005983 Bacteria 2261
43 Ga0070716_100737122 3300006173 Bacteria 757
44 Ga0070712_100347523 3300006175 Bacteria 1213
45 Ga0070712_100554329 3300006175 Bacteria 969
46 Ga0075434_100039838 3300006871 Bacteria 4653
47 Ga0075434_100484330 3300006871 Bacteria 1258
48 Ga0099794_10550764 3300007265 Bacteria 609
49 Ga0111539_12038941 3300009094 Bacteria 665
50 Ga0105248_10000003 3300009177 Bacteria 1019601
51 Ga0105248_10046679 3300009177 Bacteria 4856
52 Ga0105248_10805169 3300009177 Bacteria 1060
53 Ga0099796_10066095 3300010159 Bacteria 1295
54 Ga0105239_10001800 3300010375 Bacteria 28149
55 Ga0105246_10147488 3300011119 Bacteria 1777
56 Ga0157373_10341373 3300013100 Bacteria 1067
57 Ga0157373_11357794 3300013100 Unclassified 539
58 Ga0157371_10105943 3300013102 Bacteria 1995
59 Ga0157370_10093474 3300013104 Bacteria 2822
60 Ga0157370_10122449 3300013104 Bacteria 2428
61 Ga0157370_10233787 3300013104 Bacteria 1701
62 Ga0157370_10302273 3300013104 Bacteria 1477
63 Ga0157369_10031522 3300013105 Bacteria 5836
64 Ga0157369_10047870 3300013105 Bacteria 4641
65 Ga0157369_10074191 3300013105 Bacteria 3649
66 Ga0157369_10243354 3300013105 Bacteria 1878
67 Ga0157369_10562090 3300013105 Unclassified 1179
68 Ga0157369_11392324 3300013105 Bacteria 714
69 Ga0157378_10121541 3300013297 Bacteria 2407
70 Ga0157372_10099658 3300013307 Bacteria 3314
71 Ga0157372_10606881 3300013307 Unclassified 1275
72 Ga0157379_10050982 3300014968 Bacteria 3696
73 Ga0157376_10674849 3300014969 Bacteria 1036
74 Ga0157376_10982931 3300014969 Bacteria 866
75 Ga0206355_1161219 3300020076 Unclassified 700
76 Ga0206350_11426535 3300020080 Unclassified 532
77 Ga0213872_10022176 3300021361 Bacteria 2924
78 Ga0213876_10000089 3300021384 Bacteria 104386
79 Ga0213875_10090035 3300021388 Bacteria 1431
80 Ga0224712_10579987 3300022467 Unclassified 547
81 Ga0228598_1029524 3300024227 Bacteria 1079
82 Ga0209233_1019254 3300025261 Bacteria 1819
83 Ga0207692_10418418 3300025898 Bacteria 839
84 Ga0207680_10506582 3300025903 Bacteria 860
85 Ga0207647_10054754 3300025904 Bacteria 2454
86 Ga0207685_10682648 3300025905 Bacteria 558
87 Ga0207705_10008651 3300025909 Bacteria 7419
88 Ga0207705_10273540 3300025909 Bacteria 1292
89 Ga0207707_10037795 3300025912 Bacteria 4218
90 Ga0207707_10803335 3300025912 Bacteria 784
91 Ga0207693_10096368 3300025915 Bacteria 2319
92 Ga0207693_10181786 3300025915 Bacteria 1655
93 Ga0207693_10357412 3300025915 Bacteria 1143
94 Ga0207693_10460797 3300025915 Bacteria 993
95 Ga0207660_10010432 3300025917 Bacteria 6031
96 Ga0207652_10048371 3300025921 Bacteria 3635
97 Ga0207652_10734870 3300025921 Unclassified 879
98 Ga0207646_10101588 3300025922 Bacteria 2578
99 Ga0207646_10376563 3300025922 Unclassified 1282
100 Ga0207650_10078269 3300025925 Bacteria 2501
101 Ga0207700_11662096 3300025928 Bacteria 564
102 Ga0207700_11869021 3300025928 Bacteria 527
103 Ga0207686_10506277 3300025934 Bacteria 938
104 Ga0207665_10535390 3300025939 Bacteria 908
105 Ga0207665_10746723 3300025939 Bacteria 771
106 Ga0207711_10000013 3300025941 Bacteria 514850
107 Ga0207661_10433866 3300025944 Bacteria 1195
108 Ga0207667_10205363 3300025949 Bacteria 2020
109 Ga0207640_10657125 3300025981 Bacteria 894
110 Ga0207640_11231835 3300025981 Unclassified 666
111 Ga0207703_10101477 3300026035 Bacteria 2440
112 Ga0207678_10008175 3300026067 Bacteria 9228
113 Ga0207678_10086451 3300026067 Bacteria 2680
114 Ga0207678_10371953 3300026067 Bacteria 1235
115 Ga0207698_11646283 3300026142 Bacteria 657
116 Ga0209179_1058225 3300027512 Bacteria 836
117 Ga0265355_1017185 3300028036 Unclassified 617
118 Ga0268266_10001106 3300028379 Bacteria 33713
119 Ga0268266_10087927 3300028379 Bacteria 2719
120 Ga0268266_11081626 3300028379 Unclassified 776
121 Ga0265338_10147560 3300028800 Bacteria 1833
122 Ga0265760_10037005 3300031090 Bacteria 1448
123 Ga0265760_10041511 3300031090 Bacteria 1372
124 Ga0265316_10018684 3300031344 Bacteria 5953
125 Ga0265313_10058409 3300031595 Bacteria 1818
126 Ga0265314_10043150 3300031711 Bacteria 3209
127 Ga0265314_10400404 3300031711 Bacteria 742
128 Ga0395900_0026726 3300037418 Bacteria 5909
129 Ga0395898_0074809 3300037466 Bacteria 3272
130 Ga0395898_0119720 3300037466 Bacteria 2522
131 Ga0436364_0548200 3300037853 Bacteria 2140
132 Ga0436364_0816183 3300037853 Bacteria 3870
133 Ga0436364_0942570 3300037853 Bacteria 1309
134 Ga0436364_1203629 3300037853 Bacteria 5751
135 Ga0436364_1380142 3300037853 Bacteria 5391
136 Ga0436365_0852466 3300039437 Unclassified 535
137 Ga0436365_1738066 3300039437 Bacteria 103785
138 Ga0436360_1205311 3300039438 Bacteria 978
139 Ga0436361_0216812 3300039447 Bacteria 1412
140 Ga0436361_0261882 3300039447 Bacteria 619
141 Ga0436361_0748078 3300039447 Unclassified 583
142 Ga0436361_1109790 3300039447 Bacteria 5557
143 Ga0436363_0638964 3300039450 Bacteria 1398
144 Ga0436363_0981993 3300039450 Bacteria 849
145 Ga0436362_0057029 3300039453 Bacteria 1261
146 Ga0436362_0333296 3300039453 Bacteria 566
147 Ga0436362_0493077 3300039453 Bacteria 944
148 Ga0451802_1222912 3300041460 Bacteria 601
149 Ga0466963_0621372 3300044694 Bacteria 763
150 Ga0495650_0000006 3300046471 Bacteria 721347
151 Ga0495650_0002472 3300046471 Bacteria 14872
152 Ga0495632_0386694 3300046519 Bacteria 612
153 Ga0495648_0024438 3300046524 Bacteria 4114
154 Ga0495645_0594743 3300046543 Bacteria 681
155 Ga0495625_0002024 3300046660 Bacteria 22832
156 Ga0495625_0006673 3300046660 Bacteria 10237
157 Ga0495661_0040465 3300046665 Bacteria 2890
158 Ga0495669_0208684 3300046684 Unclassified 935
159 Ga0495613_0347428 3300046689 Bacteria 1019
160 Ga0495686_0017924 3300047472 Bacteria 4761
161 Ga0496101_0956683 3300048904 Bacteria 674
162 Ga0496107_0312994 3300048910 Bacteria 1169
163 Ga0496115_0565661 3300048918 Bacteria 907
164 Ga0496126_0001429 3300048929 Bacteria 37548
165 Ga0496126_1058883 3300048929 Bacteria 605
166 Ga0501031_0004907 3300049568 Bacteria 8692
167 Ga0501032_0001053 3300049569 Bacteria 22060
168 Ga0501033_0011227 3300049570 Bacteria 6859
169 Ga0501033_0880973 3300049570 Bacteria 602
170 Ga0501034_0007884 3300049571 Bacteria 11319
171 Ga0501036_0007012 3300049572 Bacteria 9173
172 Ga0501038_0002358 3300049574 Bacteria 17603
173 Ga0501039_0031801 3300049575 Bacteria 4069
174 Ga0501043_0000445 3300049579 Bacteria 37181
175 Ga0501046_0000036 3300049580 Bacteria 159823
176 Ga0501047_0000401 3300049581 Bacteria 48785
177 Ga0501070_0108996 3300049586 Bacteria 2288
178 Ga0501070_0434852 3300049586 Bacteria 1059
179 Ga0501073_0036298 3300049589 Bacteria 3502
180 Ga0501074_0515877 3300049590 Bacteria 847
181 Ga0501035_0037475 3300049822 Bacteria 4391
182 Ga0501035_0395794 3300049822 Unclassified 1150
183 Ga0501044_0107514 3300049823 Bacteria 2800
184 nmdc:mga0n895_217708_c1 3300050512 Unclassified 1939
185 nmdc:mga0n895_321269_c1 3300050512 Unclassified 1569
186 nmdc:mga0n895_668548_c1 3300050512 Bacteria 1036
187 nmdc:mga08x19_46994_c1 3300050514 Bacteria 2762
188 nmdc:mga0a205_1002902_c1 3300050515 Unclassified 682
189 nmdc:mga0a205_47691_c1 3300050515 Plasmid 4134
190 Ga0500651_0000006 3300053093 Bacteria 305844
191 Ga0500595_069294 3300053119 Bacteria 1049
192 Ga0500661_003513 3300055283 Bacteria 2941
193 Ga0495686_0013598
194 JGI24740J21852_10145147
195 rootH2_10269626
196 Ga0070658_10741479
197 Ga0070658_10797648
198 Ga0070683_100132077
199 Ga0070683_100539223
200 Ga0070666_10450194
201 Ga0070680_100006173
202 Ga0070711_100226493
203 Ga0070711_100548639
204 Ga0070705_100092066
205 Ga0070708_100016798
206 Ga0070708_100341186
207 Ga0070708_100407753
208 Ga0070663_100020707
209 Ga0070663_100605171
210 Ga0070663_101784696
211 Ga0070681_10028224
212 Ga0070681_10037445
213 Ga0070706_100408781
214 Ga0070707_100097766
215 Ga0070698_100450520
216 Ga0070699_100957004
217 Ga0070679_100050474
218 Ga0070679_100229538
219 Ga0070697_100018668
220 Ga0070697_100127663
221 Ga0070695_100023606
222 Ga0070665_100193341
223 Ga0070665_100226386
224 Ga0068855_100038565
225 Ga0068855_100059046
226 Ga0068855_100677583
227 Ga0068852_100211473
228 Ga0068852_100786605
229 Ga0068864_102364433
230 Ga0068858_100354371
231 Ga0081540_1006186
232 Ga0081540_1006927
233 Ga0081540_1032115
234 Ga0081540_1044602
235 Ga0070716_100737122
236 Ga0070712_100347523
237 Ga0070712_100554329
238 Ga0075434_100039838
239 Ga0075434_100484330
240 Ga0099794_10550764
241 Ga0111539_12038941
242 Ga0105248_10000003
243 Ga0105248_10046679
244 Ga0105248_10805169
245 Ga0099796_10066095
246 Ga0105239_10001800
247 Ga0105246_10147488
248 Ga0157373_10341373
249 Ga0157373_11357794
250 Ga0157371_10105943
251 Ga0157370_10093474
252 Ga0157370_10122449
253 Ga0157370_10233787
254 Ga0157370_10302273
255 Ga0157369_10031522
256 Ga0157369_10047870
257 Ga0157369_10074191
258 Ga0157369_10243354
259 Ga0157369_10562090
260 Ga0157369_11392324
261 Ga0157378_10121541
262 Ga0157372_10099658
263 Ga0157372_10606881
264 Ga0157379_10050982
265 Ga0157376_10674849
266 Ga0157376_10982931
267 Ga0206355_1161219
268 Ga0206350_11426535
269 Ga0213872_10022176
270 Ga0213876_10000089
271 Ga0213875_10090035
272 Ga0224712_10579987
273 Ga0228598_1029524
274 Ga0209233_1019254
275 Ga0207692_10418418
276 Ga0207680_10506582
277 Ga0207647_10054754
278 Ga0207685_10682648
279 Ga0207705_10008651
280 Ga0207705_10273540
281 Ga0207707_10037795
282 Ga0207707_10803335
283 Ga0207693_10096368
284 Ga0207693_10181786
285 Ga0207693_10357412
286 Ga0207693_10460797
287 Ga0207660_10010432
288 Ga0207652_10048371
289 Ga0207652_10734870
290 Ga0207646_10101588
291 Ga0207646_10376563
292 Ga0207650_10078269
293 Ga0207700_11662096
294 Ga0207700_11869021
295 Ga0207686_10506277
296 Ga0207665_10535390
297 Ga0207665_10746723
298 Ga0207711_10000013
299 Ga0207661_10433866
300 Ga0207667_10205363
301 Ga0207640_10657125
302 Ga0207640_11231835
303 Ga0207703_10101477
304 Ga0207678_10008175
305 Ga0207678_10086451
306 Ga0207678_10371953
307 Ga0207698_11646283
308 Ga0209179_1058225
309 Ga0265355_1017185
310 Ga0268266_10001106
311 Ga0268266_10087927
312 Ga0268266_11081626
313 Ga0265338_10147560
314 Ga0265760_10037005
315 Ga0265760_10041511
316 Ga0265316_10018684
317 Ga0265313_10058409
318 Ga0265314_10043150
319 Ga0265314_10400404
320 Ga0395900_0026726
321 Ga0395898_0074809
322 Ga0395898_0119720
323 Ga0436364_0548200
324 Ga0436364_0816183
325 Ga0436364_0942570
326 Ga0436364_1203629
327 Ga0436364_1380142
328 Ga0436365_0852466
329 Ga0436365_1738066
330 Ga0436360_1205311
331 Ga0436361_0216812
332 Ga0436361_0261882
333 Ga0436361_0748078
334 Ga0436361_1109790
335 Ga0436363_0638964
336 Ga0436363_0981993
337 Ga0436362_0057029
338 Ga0436362_0333296
339 Ga0436362_0493077
340 Ga0451802_1222912
341 Ga0466963_0621372
342 Ga0495650_0000006
343 Ga0495650_0002472
344 Ga0495632_0386694
345 Ga0495648_0024438
346 Ga0495645_0594743
347 Ga0495625_0002024
348 Ga0495625_0006673
349 Ga0495661_0040465
350 Ga0495669_0208684
351 Ga0495613_0347428
352 Ga0495686_0017924
353 Ga0496101_0956683
354 Ga0496107_0312994
355 Ga0496115_0565661
356 Ga0496126_0001429
357 Ga0496126_1058883
358 Ga0501031_0004907
359 Ga0501032_0001053
360 Ga0501033_0011227
361 Ga0501033_0880973
362 Ga0501034_0007884
363 Ga0501036_0007012
364 Ga0501038_0002358
365 Ga0501039_0031801
366 Ga0501043_0000445
367 Ga0501046_0000036
368 Ga0501047_0000401
369 Ga0501070_0108996
370 Ga0501070_0434852
371 Ga0501073_0036298
372 Ga0501074_0515877
373 Ga0501035_0037475
374 Ga0501035_0395794
375 Ga0501044_0107514
376 nmdc:mga0n895_217708_c1
377 nmdc:mga0n895_321269_c1
378 nmdc:mga0n895_668548_c1
379 nmdc:mga08x19_46994_c1
380 nmdc:mga0a205_1002902_c1
381 nmdc:mga0a205_47691_c1
382 Ga0500651_0000006
383 Ga0500595_069294
384 Ga0500661_003513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

8

110

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.9189 7 114
5cf2-assembly1.cif.gz_B crystal structure of the i80y/l114v/i116v mutant of leh 0.875 2 111
2bng-assembly1.cif.gz_B structure of an m.tuberculosis leh-like epoxide hydrolase 0.8708 2 111
2bng-assembly1.cif.gz_C-2 structure of an m.tuberculosis leh-like epoxide hydrolase 0.8689 2 111
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.868 59 100
ID Description Score Start End Superfamily
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9185 7 114 3.10.450.50
2bngA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8681 2 111 3.10.450.50
4r9lC00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8661 1 111 3.10.450.50
af_O33273_3_104_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8559 2 111 3.10.450.50
1nu3A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8551 1 111 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7T8YWD8-F1-model_v4 deleted 0.9919 4 114
AF-A0A3P1BJF2-F1-model_v4 Nuclear transport factor 2 family protein 0.9916 5 114
AF-A0A4Q3HET7-F1-model_v4 deleted 0.9896 12 114
AF-A0A537QIM1-F1-model_v4 Nuclear transport factor 2 family protein 0.9893 3 115
AF-A0A2E6LVU9-F1-model_v4 SnoaL-like domain-containing protein 0.9881 4 115

Map