F296092

General Info

Members Datasets Scaffolds Average Seq Length
192 157 384 127

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1097515|Ga0466967_1097515_270_725
Length 151
Sequence VTPRQRVSSDSPYEPAIGFSRAVRVGGRVLVSGTAPVFPDGSCPDDVTLQARRSFAIIEDALARVGASFADVVRTRMLLTDPGDAEAVGAVHGELLAGVRPAATMVAVSALLDPRWKIEIEAEAVVARRPARVLGTLLVRRAASAARNTSA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 1.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 8.85
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1097515 3300045976 Bacteria 793
2 Ga0070658_10116458 3300005327 Bacteria 2217
3 Ga0070658_10310240 3300005327 Bacteria 1346
4 Ga0070683_100472136 3300005329 Bacteria 1198
5 Ga0070680_102017775 3300005336 Bacteria 500
6 Ga0070682_100280158 3300005337 Unclassified 1215
7 Ga0068868_100143524 3300005338 Bacteria 1962
8 Ga0070674_100019999 3300005356 Bacteria 4267
9 Ga0070659_100632178 3300005366 Bacteria 922
10 Ga0070710_10854268 3300005437 Unclassified 654
11 Ga0070701_10222675 3300005438 Bacteria 1126
12 Ga0070708_101205150 3300005445 Bacteria 708
13 Ga0070662_100856949 3300005457 Bacteria 774
14 Ga0070681_10051502 3300005458 Bacteria 4107
15 Ga0068867_100176850 3300005459 Bacteria 1694
16 Ga0070706_101131227 3300005467 Unclassified 720
17 Ga0070707_100004685 3300005468 Bacteria 12818
18 Ga0070707_100006319 3300005468 Bacteria 11020
19 Ga0070707_101289190 3300005468 Bacteria 697
20 Ga0070698_100056760 3300005471 Bacteria 3966
21 Ga0070699_100399878 3300005518 Unclassified 1242
22 Ga0070679_100199017 3300005530 Bacteria 1970
23 Ga0070679_101508156 3300005530 Bacteria 619
24 Ga0070697_100953171 3300005536 Bacteria 762
25 Ga0068853_101639680 3300005539 Bacteria 623
26 Ga0070695_100084649 3300005545 Bacteria 2104
27 Ga0070695_100306455 3300005545 Bacteria 1176
28 Ga0070696_100007166 3300005546 Bacteria 7445
29 Ga0070704_100035862 3300005549 Bacteria 3374
30 Ga0068856_100076587 3300005614 Bacteria 3314
31 Ga0068866_10000840 3300005718 Bacteria 13623
32 Ga0068861_100043038 3300005719 Bacteria 3387
33 Ga0068860_100558792 3300005843 Bacteria 1147
34 Ga0081455_10048236 3300005937 Bacteria 3682
35 Ga0081538_10021028 3300005981 Bacteria 4783
36 Ga0075364_10042463 3300006051 Bacteria 2954
37 Ga0075428_100000001 3300006844 Bacteria 772630
38 Ga0075434_100161035 3300006871 Unclassified 2264
39 Ga0068865_100020548 3300006881 Bacteria 4283
40 Ga0105245_11527439 3300009098 Unclassified 719
41 Ga0105243_10015317 3300009148 Bacteria 5800
42 Ga0105241_10406359 3300009174 Bacteria 1195
43 Ga0105242_10006084 3300009176 Bacteria 9306
44 Ga0105239_11220407 3300010375 Unclassified 867
45 Ga0157378_10005898 3300013297 Bacteria 10731
46 Ga0157372_11936160 3300013307 Bacteria 677
47 Ga0157375_12197380 3300013308 Unclassified 657
48 Ga0206354_10495175 3300020081 Bacteria 1844
49 Ga0206353_11423849 3300020082 Bacteria 6614
50 Ga0207642_10006091 3300025899 Bacteria 3987
51 Ga0207705_10014803 3300025909 Bacteria 5608
52 Ga0207705_10334181 3300025909 Bacteria 1166
53 Ga0207684_10086113 3300025910 Unclassified 2676
54 Ga0207654_10828551 3300025911 Bacteria 669
55 Ga0207707_10022793 3300025912 Bacteria 5475
56 Ga0207707_10253859 3300025912 Bacteria 1527
57 Ga0207660_11019893 3300025917 Bacteria 675
58 Ga0207657_10001226 3300025919 Bacteria 27377
59 Ga0207646_10000419 3300025922 Bacteria 56715
60 Ga0207646_10006232 3300025922 Bacteria 12395
61 Ga0207664_11913643 3300025929 Bacteria 516
62 Ga0207706_10543731 3300025933 Bacteria 1000
63 Ga0207686_10003002 3300025934 Bacteria 9101
64 Ga0207709_10047682 3300025935 Bacteria 2606
65 Ga0207669_10636932 3300025937 Bacteria 870
66 Ga0207704_10106259 3300025938 Bacteria 1885
67 Ga0207712_10478121 3300025961 Bacteria 1061
68 Ga0207658_10712177 3300025986 Unclassified 908
69 Ga0207702_10031083 3300026078 Bacteria 4451
70 Ga0207702_10550252 3300026078 Bacteria 1129
71 Ga0207648_10115613 3300026089 Bacteria 2358
72 Ga0207675_100035863 3300026118 Bacteria 4626
73 Ga0265338_10003243 3300028800 Bacteria 23129
74 Ga0265338_10036158 3300028800 Bacteria 4732
75 Ga0265760_10202016 3300031090 Unclassified 672
76 Ga0265320_10018043 3300031240 Bacteria 3898
77 Ga0265325_10007066 3300031241 Bacteria 6758
78 Ga0265325_10074946 3300031241 Bacteria 1691
79 Ga0265340_10000565 3300031247 Bacteria 20551
80 Ga0265339_10006501 3300031249 Bacteria 7661
81 Ga0265331_10157805 3300031250 Bacteria 1029
82 Ga0265327_10032670 3300031251 Bacteria 2909
83 Ga0265316_10041770 3300031344 Bacteria 3668
84 Ga0307408_101566911 3300031548 Bacteria 625
85 Ga0265313_10059682 3300031595 Bacteria 1793
86 Ga0265314_10040429 3300031711 Bacteria 3347
87 Ga0265342_10027957 3300031712 Bacteria 3518
88 Ga0316576_10006775 3300031727 Bacteria 7161
89 Ga0316576_10336656 3300031727 Bacteria 1124
90 Ga0307413_12066868 3300031824 Bacteria 515
91 Ga0307409_100806311 3300031995 Bacteria 947
92 Ga0307416_102965143 3300032002 Unclassified 568
93 Ga0307415_100157411 3300032126 Bacteria 1756
94 Ga0373934_0194701 3300035086 Bacteria 834
95 Ga0373956_0413479 3300035119 Bacteria 644
96 Ga0373957_0271174 3300035120 Bacteria 716
97 Ga0373961_0089802 3300035241 Bacteria 980
98 Ga0373924_0273240 3300035410 Unclassified 749
99 Ga0373933_0160055 3300035724 Bacteria 1429
100 Ga0373937_0380541 3300036401 Bacteria 1338
101 Ga0373937_1315032 3300036401 Bacteria 671
102 Ga0373925_0809861 3300037068 Bacteria 772
103 Ga0395900_0194636 3300037418 Bacteria 2055
104 Ga0395900_0207588 3300037418 Bacteria 1979
105 Ga0395900_0234509 3300037418 Bacteria 1844
106 Ga0395898_0093554 3300037466 Bacteria 2889
107 Ga0395898_0343514 3300037466 Bacteria 1423
108 Ga0395901_0439210 3300038443 Bacteria 1336
109 Ga0395901_0842441 3300038443 Bacteria 903
110 Ga0395901_1167037 3300038443 Bacteria 737
111 Ga0436361_1085391 3300039447 Bacteria 914
112 Ga0439465_0366172 3300041413 Bacteria 546
113 Ga0451853_2493253 3300041512 Bacteria 796
114 Ga0466963_0008458 3300044694 Bacteria 6167
115 Ga0466964_0011272 3300044706 Bacteria 3377
116 Ga0466970_0035965 3300044765 Bacteria 2623
117 Ga0466957_0134020 3300044842 Bacteria 1590
118 Ga0466959_0556825 3300045049 Unclassified 773
119 Ga0466958_0239493 3300045836 Bacteria 1159
120 Ga0466958_0467435 3300045836 Unclassified 817
121 Ga0466967_0000068 3300045976 Bacteria 37810
122 Ga0466967_0034147 3300045976 Bacteria 4314
123 Ga0466967_0115088 3300045976 Bacteria 2476
124 Ga0466967_1395154 3300045976 Unclassified 698
125 Ga0495592_0620863 3300046454 Bacteria 657
126 Ga0495603_0001869 3300046455 Bacteria 12408
127 Ga0495591_045111 3300046458 Bacteria 1231
128 Ga0495651_0244440 3300046462 Bacteria 1229
129 Ga0495653_0413720 3300046463 Bacteria 854
130 Ga0495664_0877055 3300046477 Bacteria 525
131 Ga0495584_0393545 3300046491 Bacteria 704
132 Ga0495608_0017292 3300046511 Bacteria 4989
133 Ga0495608_0500022 3300046511 Unclassified 736
134 Ga0495618_0076965 3300046514 Bacteria 2126
135 Ga0495618_0505223 3300046514 Unclassified 728
136 Ga0495628_0931330 3300046516 Bacteria 601
137 Ga0495630_0418461 3300046517 Bacteria 1027
138 Ga0495637_0211476 3300046520 Bacteria 709
139 Ga0495663_0068604 3300046525 Bacteria 1126
140 Ga0495642_0011034 3300046528 Bacteria 3466
141 Ga0495652_0420658 3300046529 Bacteria 942
142 Ga0495652_1052245 3300046529 Bacteria 530
143 Ga0495667_0011349 3300046559 Bacteria 6033
144 Ga0495667_0611982 3300046559 Bacteria 678
145 Ga0495656_0231585 3300046615 Bacteria 927
146 Ga0495634_0015789 3300046642 Bacteria 5415
147 Ga0495634_0741519 3300046642 Bacteria 563
148 Ga0495635_0018280 3300046663 Bacteria 4893
149 Ga0495657_0009299 3300046675 Bacteria 7458
150 Ga0495599_0442086 3300046678 Bacteria 771
151 Ga0495599_0824310 3300046678 Bacteria 529
152 Ga0495613_0747745 3300046689 Bacteria 641
153 Ga0495670_0461224 3300046691 Bacteria 689
154 Ga0495600_0821687 3300046809 Bacteria 552
155 Ga0495604_0245329 3300047317 Bacteria 1223
156 Ga0495680_0018472 3300047322 Bacteria 5918
157 Ga0495684_0017843 3300047471 Bacteria 5467
158 Ga0495684_0043121 3300047471 Bacteria 3454
159 Ga0495602_0295434 3300048088 Bacteria 1188
160 Ga0496100_0002676 3300048903 Bacteria 9083
161 Ga0496101_0189073 3300048904 Unclassified 1588
162 Ga0496102_0219719 3300048905 Bacteria 1791
163 Ga0496104_0011259 3300048907 Bacteria 8006
164 Ga0496104_1327331 3300048907 Bacteria 622
165 Ga0496105_0000738 3300048908 Bacteria 22174
166 Ga0496105_0133013 3300048908 Unclassified 2049
167 Ga0496106_0252096 3300048909 Bacteria 1411
168 Ga0496107_0276082 3300048910 Bacteria 1251
169 Ga0496108_0015271 3300048911 Bacteria 6267
170 Ga0496109_0002771 3300048912 Bacteria 14687
171 Ga0496110_0000219 3300048913 Bacteria 37065
172 Ga0496111_0000345 3300048914 Bacteria 22979
173 Ga0496112_0064574 3300048915 Bacteria 3612
174 Ga0496112_0680734 3300048915 Unclassified 957
175 Ga0496113_0271778 3300048916 Bacteria 1355
176 Ga0496114_0001772 3300048917 Bacteria 16373
177 Ga0501036_1750780 3300049572 Unclassified 500
178 Ga0501038_1229697 3300049574 Bacteria 543
179 Ga0501041_0495179 3300049577 Bacteria 777
180 Ga0501071_0861980 3300049587 Bacteria 699
181 Ga0501072_1344902 3300049588 Bacteria 553
182 Ga0501076_0479789 3300049592 Bacteria 1025
183 Ga0501081_0917658 3300049743 Bacteria 661
184 nmdc:mga00v17_112438_c1 3300050491 Bacteria 1728
185 nmdc:mga0n895_171876_c1 3300050512 Unclassified 2199
186 nmdc:mga0n895_1838561_c1 3300050512 Unclassified 566
187 nmdc:mga0n895_401560_c1 3300050512 Unclassified 1386
188 Ga0495601_0163896 3300053077 Bacteria 1453
189 Ga0495655_0011842 3300053083 Bacteria 1763
190 Ga0495595_0025587 3300053084 Bacteria 2617
191 Ga0495619_0215134 3300053085 Bacteria 1331
192 Ga0501082_0871204 3300060353 Bacteria 788
193 Ga0466967_1097515
194 Ga0070658_10116458
195 Ga0070658_10310240
196 Ga0070683_100472136
197 Ga0070680_102017775
198 Ga0070682_100280158
199 Ga0068868_100143524
200 Ga0070674_100019999
201 Ga0070659_100632178
202 Ga0070710_10854268
203 Ga0070701_10222675
204 Ga0070708_101205150
205 Ga0070662_100856949
206 Ga0070681_10051502
207 Ga0068867_100176850
208 Ga0070706_101131227
209 Ga0070707_100004685
210 Ga0070707_100006319
211 Ga0070707_101289190
212 Ga0070698_100056760
213 Ga0070699_100399878
214 Ga0070679_100199017
215 Ga0070679_101508156
216 Ga0070697_100953171
217 Ga0068853_101639680
218 Ga0070695_100084649
219 Ga0070695_100306455
220 Ga0070696_100007166
221 Ga0070704_100035862
222 Ga0068856_100076587
223 Ga0068866_10000840
224 Ga0068861_100043038
225 Ga0068860_100558792
226 Ga0081455_10048236
227 Ga0081538_10021028
228 Ga0075364_10042463
229 Ga0075428_100000001
230 Ga0075434_100161035
231 Ga0068865_100020548
232 Ga0105245_11527439
233 Ga0105243_10015317
234 Ga0105241_10406359
235 Ga0105242_10006084
236 Ga0105239_11220407
237 Ga0157378_10005898
238 Ga0157372_11936160
239 Ga0157375_12197380
240 Ga0206354_10495175
241 Ga0206353_11423849
242 Ga0207642_10006091
243 Ga0207705_10014803
244 Ga0207705_10334181
245 Ga0207684_10086113
246 Ga0207654_10828551
247 Ga0207707_10022793
248 Ga0207707_10253859
249 Ga0207660_11019893
250 Ga0207657_10001226
251 Ga0207646_10000419
252 Ga0207646_10006232
253 Ga0207664_11913643
254 Ga0207706_10543731
255 Ga0207686_10003002
256 Ga0207709_10047682
257 Ga0207669_10636932
258 Ga0207704_10106259
259 Ga0207712_10478121
260 Ga0207658_10712177
261 Ga0207702_10031083
262 Ga0207702_10550252
263 Ga0207648_10115613
264 Ga0207675_100035863
265 Ga0265338_10003243
266 Ga0265338_10036158
267 Ga0265760_10202016
268 Ga0265320_10018043
269 Ga0265325_10007066
270 Ga0265325_10074946
271 Ga0265340_10000565
272 Ga0265339_10006501
273 Ga0265331_10157805
274 Ga0265327_10032670
275 Ga0265316_10041770
276 Ga0307408_101566911
277 Ga0265313_10059682
278 Ga0265314_10040429
279 Ga0265342_10027957
280 Ga0316576_10006775
281 Ga0316576_10336656
282 Ga0307413_12066868
283 Ga0307409_100806311
284 Ga0307416_102965143
285 Ga0307415_100157411
286 Ga0373934_0194701
287 Ga0373956_0413479
288 Ga0373957_0271174
289 Ga0373961_0089802
290 Ga0373924_0273240
291 Ga0373933_0160055
292 Ga0373937_0380541
293 Ga0373937_1315032
294 Ga0373925_0809861
295 Ga0395900_0194636
296 Ga0395900_0207588
297 Ga0395900_0234509
298 Ga0395898_0093554
299 Ga0395898_0343514
300 Ga0395901_0439210
301 Ga0395901_0842441
302 Ga0395901_1167037
303 Ga0436361_1085391
304 Ga0439465_0366172
305 Ga0451853_2493253
306 Ga0466963_0008458
307 Ga0466964_0011272
308 Ga0466970_0035965
309 Ga0466957_0134020
310 Ga0466959_0556825
311 Ga0466958_0239493
312 Ga0466958_0467435
313 Ga0466967_0000068
314 Ga0466967_0034147
315 Ga0466967_0115088
316 Ga0466967_1395154
317 Ga0495592_0620863
318 Ga0495603_0001869
319 Ga0495591_045111
320 Ga0495651_0244440
321 Ga0495653_0413720
322 Ga0495664_0877055
323 Ga0495584_0393545
324 Ga0495608_0017292
325 Ga0495608_0500022
326 Ga0495618_0076965
327 Ga0495618_0505223
328 Ga0495628_0931330
329 Ga0495630_0418461
330 Ga0495637_0211476
331 Ga0495663_0068604
332 Ga0495642_0011034
333 Ga0495652_0420658
334 Ga0495652_1052245
335 Ga0495667_0011349
336 Ga0495667_0611982
337 Ga0495656_0231585
338 Ga0495634_0015789
339 Ga0495634_0741519
340 Ga0495635_0018280
341 Ga0495657_0009299
342 Ga0495599_0442086
343 Ga0495599_0824310
344 Ga0495613_0747745
345 Ga0495670_0461224
346 Ga0495600_0821687
347 Ga0495604_0245329
348 Ga0495680_0018472
349 Ga0495684_0017843
350 Ga0495684_0043121
351 Ga0495602_0295434
352 Ga0496100_0002676
353 Ga0496101_0189073
354 Ga0496102_0219719
355 Ga0496104_0011259
356 Ga0496104_1327331
357 Ga0496105_0000738
358 Ga0496105_0133013
359 Ga0496106_0252096
360 Ga0496107_0276082
361 Ga0496108_0015271
362 Ga0496109_0002771
363 Ga0496110_0000219
364 Ga0496111_0000345
365 Ga0496112_0064574
366 Ga0496112_0680734
367 Ga0496113_0271778
368 Ga0496114_0001772
369 Ga0501036_1750780
370 Ga0501038_1229697
371 Ga0501041_0495179
372 Ga0501071_0861980
373 Ga0501072_1344902
374 Ga0501076_0479789
375 Ga0501081_0917658
376 nmdc:mga00v17_112438_c1
377 nmdc:mga0n895_171876_c1
378 nmdc:mga0n895_1838561_c1
379 nmdc:mga0n895_401560_c1
380 Ga0495601_0163896
381 Ga0495655_0011842
382 Ga0495595_0025587
383 Ga0495619_0215134
384 Ga0501082_0871204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

9

126

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9512 2 122
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9434 2 122
3k12-assembly1.cif.gz_C crystal structure of an uncharacterized protein a6v7t0 from pseudomonas aeruginosa 0.9248 20 123
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9176 20 123
3gtz-assembly1.cif.gz_C crystal structure of a putative translation initiation inhibitor from salmonella typhimurium 0.9166 21 122
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9512 2 122 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9434 2 122 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9239 18 122 3.30.1330.40
3k12C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9176 22 123 3.30.1330.40
2ig8C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9158 2 122 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7V9LV53-F1-model_v4 RidA family protein 0.9914 42 123
AF-E8X371-F1-model_v4 Endoribonuclease L-PSP 0.982 2 123
AF-A0A7W0G8B3-F1-model_v4 RidA family protein 0.9808 37 123
AF-E9SVR3-F1-model_v4 Endoribonuclease L-PSP 0.9759 1 123
AF-A0A0A3YHC9-F1-model_v4 deleted 0.9756 4 122

Map