F295970

General Info

Members Datasets Scaffolds Average Seq Length
192 146 384 134

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_1161846|Ga0395905_1161846_39_494
Length 151
Sequence MGTGHRRADRPVTPAELFASARVARLATVDPDGAPHLVPIVFALVGDVIHSAVDAKPKRHSRLRRLANIAHEPRVSVLVDHYDDDWNALWWVRADGTAAVLETSPEGLAALARKYPQYLVTPPPGPFLSIEVRRWSAWSATPGLSSTTDAI

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
72 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
73 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
134 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
135 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
136 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
139 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
140 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
141 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
142 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
143 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
144 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
145 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
146 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 1.04
Rhizoplane 2.6
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_1161846 3300037471 Bacteria 675
2 Ga0070680_101554215 3300005336 Unclassified 573
3 Ga0070689_101282747 3300005340 Bacteria 659
4 Ga0070668_100016568 3300005347 Bacteria 5509
5 Ga0070669_100121405 3300005353 Bacteria 1994
6 Ga0070675_100486300 3300005354 Unclassified 1111
7 Ga0070713_101734748 3300005436 Bacteria 606
8 Ga0070705_100541199 3300005440 Bacteria 891
9 Ga0070708_100041661 3300005445 Bacteria 4026
10 Ga0070662_100702654 3300005457 Bacteria 855
11 Ga0070662_100964251 3300005457 Bacteria 729
12 Ga0070699_102040965 3300005518 Unclassified 524
13 Ga0070672_100754884 3300005543 Bacteria 854
14 Ga0070695_100331143 3300005545 Bacteria 1135
15 Ga0070695_101078172 3300005545 Unclassified 656
16 Ga0070696_100004942 3300005546 Bacteria 8901
17 Ga0070665_100147210 3300005548 Bacteria 2358
18 Ga0068859_101188539 3300005617 Unclassified 840
19 Ga0068866_10352204 3300005718 Bacteria 936
20 Ga0068863_100273523 3300005841 Bacteria 1635
21 Ga0068863_101790581 3300005841 Bacteria 624
22 Ga0068858_100466055 3300005842 Bacteria 1218
23 Ga0068862_100036572 3300005844 Bacteria 4162
24 Ga0068862_100284263 3300005844 Bacteria 1517
25 Ga0081539_10000348 3300005985 Bacteria 101459
26 Ga0081539_10016645 3300005985 Bacteria 5230
27 Ga0081539_10298120 3300005985 Bacteria 694
28 Ga0075434_100674596 3300006871 Unclassified 1051
29 Ga0097620_101188577 3300006931 Unclassified 840
30 Ga0075435_100510292 3300007076 Bacteria 1040
31 Ga0105251_10094426 3300009011 Bacteria 1371
32 Ga0105245_10068406 3300009098 Bacteria 3218
33 Ga0105245_10987068 3300009098 Bacteria 886
34 Ga0105247_10207058 3300009101 Bacteria 1321
35 Ga0114129_12364266 3300009147 Bacteria 637
36 Ga0105243_10699174 3300009148 Bacteria 988
37 Ga0105243_10707130 3300009148 Bacteria 983
38 Ga0105241_10570325 3300009174 Bacteria 1019
39 Ga0105242_10369651 3300009176 Bacteria 1330
40 Ga0105248_10237511 3300009177 Bacteria 2052
41 Ga0105239_10154952 3300010375 Bacteria 2558
42 Ga0157378_10027702 3300013297 Bacteria 4997
43 Ga0157378_10192924 3300013297 Bacteria 1923
44 Ga0163163_10243267 3300014325 Bacteria 1849
45 Ga0163163_10311031 3300014325 Bacteria 1628
46 Ga0163163_10909335 3300014325 Bacteria 943
47 Ga0157380_11947017 3300014326 Unclassified 649
48 Ga0157376_10201162 3300014969 Bacteria 1833
49 Ga0207654_10745941 3300025911 Bacteria 705
50 Ga0207660_10692632 3300025917 Bacteria 831
51 Ga0207681_10111556 3300025923 Bacteria 1990
52 Ga0207650_10758528 3300025925 Unclassified 821
53 Ga0207687_10055316 3300025927 Bacteria 2780
54 Ga0207686_10138784 3300025934 Bacteria 1677
55 Ga0207709_10462125 3300025935 Bacteria 983
56 Ga0207691_10640311 3300025940 Bacteria 899
57 Ga0207711_10357984 3300025941 Bacteria 1352
58 Ga0207668_10000408 3300025972 Bacteria 27061
59 Ga0207703_10414628 3300026035 Bacteria 1252
60 Ga0207641_10259816 3300026088 Bacteria 1625
61 Ga0207676_10163394 3300026095 Bacteria 1932
62 Ga0207675_101280778 3300026118 Bacteria 753
63 Ga0207683_11321245 3300026121 Bacteria 667
64 Ga0268266_11031026 3300028379 Bacteria 796
65 Ga0268265_10397349 3300028380 Bacteria 1273
66 Ga0307517_10023115 3300028786 Bacteria 7748
67 Ga0307517_10081005 3300028786 Bacteria 2773
68 Ga0307515_10000694 3300028794 Bacteria 77618
69 Ga0307515_10061641 3300028794 Bacteria 5315
70 Ga0307512_10003576 3300030522 Bacteria 17848
71 Ga0307512_10028715 3300030522 Bacteria 4871
72 Ga0307512_10107560 3300030522 Bacteria 1855
73 Ga0307509_10276110 3300031507 Bacteria 1445
74 Ga0307408_100581183 3300031548 Bacteria 993
75 Ga0307408_100596482 3300031548 Bacteria 981
76 Ga0307508_10019589 3300031616 Bacteria 6149
77 Ga0307508_10032296 3300031616 Bacteria 4729
78 Ga0307508_10224913 3300031616 Bacteria 1476
79 Ga0307516_10213792 3300031730 Bacteria 1641
80 Ga0307516_10296080 3300031730 Bacteria 1295
81 Ga0307516_10323484 3300031730 Bacteria 1213
82 Ga0307516_10762403 3300031730 Bacteria 627
83 Ga0307413_10043154 3300031824 Bacteria 2656
84 Ga0326468_10068797 3300031889 Bacteria 583
85 Ga0307406_10254158 3300031901 Bacteria 1326
86 Ga0307409_100519303 3300031995 Bacteria 1163
87 Ga0307416_100273747 3300032002 Bacteria 1660
88 Ga0307416_101075329 3300032002 Bacteria 909
89 Ga0307507_10149678 3300033179 Bacteria 1761
90 Ga0307510_10027340 3300033180 Bacteria 6537
91 Ga0373948_0007386 3300034817 Bacteria 1847
92 Ga0373926_0074056 3300035083 Bacteria 1254
93 Ga0373940_0021732 3300035088 Bacteria 1643
94 Ga0373951_0000014 3300035091 Bacteria 69945
95 Ga0373941_0003755 3300035115 Bacteria 3467
96 Ga0373945_0132731 3300035116 Bacteria 999
97 Ga0373946_0412559 3300035171 Bacteria 683
98 Ga0373942_0006954 3300035207 Bacteria 2614
99 Ga0373935_0245701 3300035692 Bacteria 1251
100 Ga0373927_0302282 3300035695 Bacteria 1053
101 Ga0373937_0654829 3300036401 Bacteria 996
102 Ga0373925_0102208 3300037068 Bacteria 2205
103 Ga0395899_0195076 3300037312 Bacteria 1415
104 Ga0395900_0038642 3300037418 Bacteria 4920
105 Ga0395900_0207753 3300037418 Bacteria 1978
106 Ga0395900_0373374 3300037418 Bacteria 1395
107 Ga0395900_0440257 3300037418 Bacteria 1261
108 Ga0395900_0683936 3300037418 Unclassified 960
109 Ga0395898_0023149 3300037466 Bacteria 6279
110 Ga0395898_0880169 3300037466 Bacteria 834
111 Ga0395905_0150455 3300037471 Bacteria 2190
112 Ga0395905_0293990 3300037471 Bacteria 1511
113 Ga0395901_0015203 3300038443 Bacteria 7830
114 Ga0395901_0053294 3300038443 Bacteria 4203
115 Ga0395901_0155147 3300038443 Bacteria 2405
116 Ga0395901_0251037 3300038443 Bacteria 1843
117 Ga0395901_0919542 3300038443 Bacteria 855
118 Ga0436362_0580485 3300039453 Bacteria 611
119 Ga0439438_099683 3300041405 Unclassified 705
120 Ga0451843_0820755 3300041509 Bacteria 769
121 Ga0451853_1987935 3300041512 Bacteria 1622
122 Ga0466969_0109962 3300044656 Bacteria 1291
123 Ga0466965_0096119 3300044683 Bacteria 1511
124 Ga0466966_0012519 3300044684 Bacteria 5619
125 Ga0466966_0040656 3300044684 Bacteria 2992
126 Ga0466963_0006344 3300044694 Bacteria 6992
127 Ga0466963_0183234 3300044694 Bacteria 1462
128 Ga0466971_0015219 3300044719 Bacteria 3385
129 Ga0466968_0229680 3300044735 Bacteria 876
130 Ga0466957_0016385 3300044842 Bacteria 4335
131 Ga0466957_0392276 3300044842 Bacteria 948
132 Ga0466958_0000771 3300045836 Bacteria 14088
133 Ga0466967_0038048 3300045976 Bacteria 4123
134 Ga0466967_0045515 3300045976 Bacteria 3813
135 Ga0466967_0049045 3300045976 Bacteria 3691
136 Ga0466967_0213049 3300045976 Bacteria 1833
137 Ga0495629_0017925 3300046459 Bacteria 5075
138 Ga0495629_0986955 3300046459 Bacteria 549
139 Ga0495653_0209074 3300046463 Bacteria 1319
140 Ga0495582_0166818 3300046473 Bacteria 1253
141 Ga0495584_0112201 3300046491 Bacteria 1380
142 Ga0495608_0188161 3300046511 Bacteria 1304
143 Ga0495620_0166766 3300046515 Bacteria 855
144 Ga0495630_0127731 3300046517 Bacteria 1930
145 Ga0495644_0281569 3300046523 Bacteria 649
146 Ga0495667_0078210 3300046559 Bacteria 2151
147 Ga0495656_0353502 3300046615 Bacteria 762
148 Ga0495634_0054458 3300046642 Bacteria 2678
149 Ga0495625_0015713 3300046660 Bacteria 5981
150 Ga0495635_0292967 3300046663 Bacteria 1092
151 Ga0495659_0108306 3300046664 Bacteria 1083
152 Ga0495659_0456557 3300046664 Bacteria 556
153 Ga0495588_0004165 3300046674 Bacteria 6375
154 Ga0495588_0136843 3300046674 Bacteria 1293
155 Ga0495657_0224516 3300046675 Bacteria 1138
156 Ga0495599_0791814 3300046678 Unclassified 542
157 Ga0495613_0084715 3300046689 Bacteria 2301
158 Ga0495613_0835870 3300046689 Bacteria 599
159 Ga0495649_0063399 3300046694 Bacteria 1986
160 Ga0495581_0297295 3300047315 Bacteria 944
161 Ga0495676_0272789 3300047321 Bacteria 1147
162 Ga0495676_0789982 3300047321 Bacteria 611
163 Ga0495680_0598414 3300047322 Bacteria 738
164 Ga0495681_0000495 3300047470 Bacteria 30163
165 Ga0495684_0069932 3300047471 Bacteria 2669
166 Ga0496102_0344254 3300048905 Bacteria 1404
167 Ga0496105_0315110 3300048908 Bacteria 1255
168 Ga0496108_0000206 3300048911 Bacteria 54394
169 Ga0496112_0209389 3300048915 Bacteria 1907
170 Ga0496112_0904436 3300048915 Unclassified 804
171 Ga0496126_0017305 3300048929 Bacteria 7183
172 Ga0501034_0352727 3300049571 Bacteria 1399
173 Ga0501047_0502109 3300049581 Bacteria 1040
174 Ga0501073_0566310 3300049589 Bacteria 785
175 nmdc:mga0n895_142978_c1 3300050512 Bacteria 2421
176 nmdc:mga0rr50_482450_c1 3300050513 Unclassified 1053
177 Ga0495619_0072662 3300053085 Bacteria 2304
178 Ga0500560_205757 3300053107 Bacteria 634
179 Ga0500561_0211298 3300053137 Bacteria 615
180 Ga0500579_170937 3300053143 Bacteria 885
181 Ga0500600_0202827 3300053149 Bacteria 932
182 Ga0500600_0293974 3300053149 Unclassified 700
183 Ga0501082_0567046 3300060353 Bacteria 993
184 2862389272 2862382967 Bacteria 10317375
185 2904768545 2904765812 Bacteria 5369154
186 2904772182 2904770941 Bacteria 5580202
187 2908815838 2908811453 Bacteria 5478616
188 2912721058 2912715099 Bacteria 9460473
189 2919421921 2919420072 Bacteria 5390363
190 2919434521 2919432681 Bacteria 5390474
191 2954007577 2954002825 Bacteria 9173742
192 8008559945 8008558824 Bacteria 10610750
193 Ga0395905_1161846
194 Ga0070680_101554215
195 Ga0070689_101282747
196 Ga0070668_100016568
197 Ga0070669_100121405
198 Ga0070675_100486300
199 Ga0070713_101734748
200 Ga0070705_100541199
201 Ga0070708_100041661
202 Ga0070662_100702654
203 Ga0070662_100964251
204 Ga0070699_102040965
205 Ga0070672_100754884
206 Ga0070695_100331143
207 Ga0070695_101078172
208 Ga0070696_100004942
209 Ga0070665_100147210
210 Ga0068859_101188539
211 Ga0068866_10352204
212 Ga0068863_100273523
213 Ga0068863_101790581
214 Ga0068858_100466055
215 Ga0068862_100036572
216 Ga0068862_100284263
217 Ga0081539_10000348
218 Ga0081539_10016645
219 Ga0081539_10298120
220 Ga0075434_100674596
221 Ga0097620_101188577
222 Ga0075435_100510292
223 Ga0105251_10094426
224 Ga0105245_10068406
225 Ga0105245_10987068
226 Ga0105247_10207058
227 Ga0114129_12364266
228 Ga0105243_10699174
229 Ga0105243_10707130
230 Ga0105241_10570325
231 Ga0105242_10369651
232 Ga0105248_10237511
233 Ga0105239_10154952
234 Ga0157378_10027702
235 Ga0157378_10192924
236 Ga0163163_10243267
237 Ga0163163_10311031
238 Ga0163163_10909335
239 Ga0157380_11947017
240 Ga0157376_10201162
241 Ga0207654_10745941
242 Ga0207660_10692632
243 Ga0207681_10111556
244 Ga0207650_10758528
245 Ga0207687_10055316
246 Ga0207686_10138784
247 Ga0207709_10462125
248 Ga0207691_10640311
249 Ga0207711_10357984
250 Ga0207668_10000408
251 Ga0207703_10414628
252 Ga0207641_10259816
253 Ga0207676_10163394
254 Ga0207675_101280778
255 Ga0207683_11321245
256 Ga0268266_11031026
257 Ga0268265_10397349
258 Ga0307517_10023115
259 Ga0307517_10081005
260 Ga0307515_10000694
261 Ga0307515_10061641
262 Ga0307512_10003576
263 Ga0307512_10028715
264 Ga0307512_10107560
265 Ga0307509_10276110
266 Ga0307408_100581183
267 Ga0307408_100596482
268 Ga0307508_10019589
269 Ga0307508_10032296
270 Ga0307508_10224913
271 Ga0307516_10213792
272 Ga0307516_10296080
273 Ga0307516_10323484
274 Ga0307516_10762403
275 Ga0307413_10043154
276 Ga0326468_10068797
277 Ga0307406_10254158
278 Ga0307409_100519303
279 Ga0307416_100273747
280 Ga0307416_101075329
281 Ga0307507_10149678
282 Ga0307510_10027340
283 Ga0373948_0007386
284 Ga0373926_0074056
285 Ga0373940_0021732
286 Ga0373951_0000014
287 Ga0373941_0003755
288 Ga0373945_0132731
289 Ga0373946_0412559
290 Ga0373942_0006954
291 Ga0373935_0245701
292 Ga0373927_0302282
293 Ga0373937_0654829
294 Ga0373925_0102208
295 Ga0395899_0195076
296 Ga0395900_0038642
297 Ga0395900_0207753
298 Ga0395900_0373374
299 Ga0395900_0440257
300 Ga0395900_0683936
301 Ga0395898_0023149
302 Ga0395898_0880169
303 Ga0395905_0150455
304 Ga0395905_0293990
305 Ga0395901_0015203
306 Ga0395901_0053294
307 Ga0395901_0155147
308 Ga0395901_0251037
309 Ga0395901_0919542
310 Ga0436362_0580485
311 Ga0439438_099683
312 Ga0451843_0820755
313 Ga0451853_1987935
314 Ga0466969_0109962
315 Ga0466965_0096119
316 Ga0466966_0012519
317 Ga0466966_0040656
318 Ga0466963_0006344
319 Ga0466963_0183234
320 Ga0466971_0015219
321 Ga0466968_0229680
322 Ga0466957_0016385
323 Ga0466957_0392276
324 Ga0466958_0000771
325 Ga0466967_0038048
326 Ga0466967_0045515
327 Ga0466967_0049045
328 Ga0466967_0213049
329 Ga0495629_0017925
330 Ga0495629_0986955
331 Ga0495653_0209074
332 Ga0495582_0166818
333 Ga0495584_0112201
334 Ga0495608_0188161
335 Ga0495620_0166766
336 Ga0495630_0127731
337 Ga0495644_0281569
338 Ga0495667_0078210
339 Ga0495656_0353502
340 Ga0495634_0054458
341 Ga0495625_0015713
342 Ga0495635_0292967
343 Ga0495659_0108306
344 Ga0495659_0456557
345 Ga0495588_0004165
346 Ga0495588_0136843
347 Ga0495657_0224516
348 Ga0495599_0791814
349 Ga0495613_0084715
350 Ga0495613_0835870
351 Ga0495649_0063399
352 Ga0495581_0297295
353 Ga0495676_0272789
354 Ga0495676_0789982
355 Ga0495680_0598414
356 Ga0495681_0000495
357 Ga0495684_0069932
358 Ga0496102_0344254
359 Ga0496105_0315110
360 Ga0496108_0000206
361 Ga0496112_0209389
362 Ga0496112_0904436
363 Ga0496126_0017305
364 Ga0501034_0352727
365 Ga0501047_0502109
366 Ga0501073_0566310
367 nmdc:mga0n895_142978_c1
368 nmdc:mga0rr50_482450_c1
369 Ga0495619_0072662
370 Ga0500560_205757
371 Ga0500561_0211298
372 Ga0500579_170937
373 Ga0500600_0202827
374 Ga0500600_0293974
375 Ga0501082_0567046
376 2862389272
377 2904768545
378 2904772182
379 2908815838
380 2912721058
381 2919421921
382 2919434521
383 2954007577
384 8008559945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

13

105

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jv4-assembly3.cif.gz_F structure of f420 binding protein, msmeg_6526, from mycobacterium smegmatis with f420 bound 0.8814 5 130
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.8567 4 127
5jv4-assembly3.cif.gz_F structure of f420 binding protein, msmeg_6526, from mycobacterium smegmatis with f420 bound 0.8266 5 130
6ymh-assembly1.cif.gz_AAA x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.8187 12 134
3u0i-assembly1.cif.gz_A-2 crystal structure of a probable fad-binding, putative uncharacterized protein from brucella melitensis 0.8125 3 127
ID Description Score Start End Superfamily
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8567 4 127 2.30.110.10
5jv4A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8435 1 130 2.30.110.10
5jv4A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8144 1 130 2.30.110.10
3u0iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8125 3 127 2.30.110.10
af_I1KGP8_130_285_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7907 3 131 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A561BLV3-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9713 3 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A850CWJ1-F1-model_v4 deleted 0.9692 3 129
AF-A0A4R8CT00-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9673 8 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A4R8S696-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9617 13 130 GO:0005829
GO:0016627
GO:0070967
AF-A0A1Y5XXA0-F1-model_v4 PPOX class probable F420-dependent enzyme, Rv0121 family 0.9604 6 129 GO:0005829
GO:0016627
GO:0070967

Map