F295717

General Info

Members Datasets Scaffolds Average Seq Length
192 100 384 122

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10002616|Ga0213875_100026165
Length 135
Sequence VGKTAEAAREIPLQVRLFETGPDPFGRTWKVQFRWLQTGISIRHADTVDVKFLITSAGEPPQEKVVALPHLALLELTGGRGEKLSDPLCMRLAALHLIRMIETFEDMEKTLVTVSPQELAAYDKQLHDETVTRRR

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.6
Rhizosphere 67.71
Stem 0
Stem Tuber 0
Unclassified 21.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10002616 3300021388 Bacteria 10680
2 JGI24737J22298_10151356 3300001990 Bacteria 685
3 Ga0070660_100049384 3300005339 Bacteria 3234
4 Ga0070660_100954126 3300005339 Bacteria 724
5 Ga0070689_100521570 3300005340 Bacteria 1020
6 Ga0070661_100194381 3300005344 Bacteria 1548
7 Ga0070688_100287315 3300005365 Bacteria 1184
8 Ga0070659_100089331 3300005366 Unclassified 2468
9 Ga0070659_100178621 3300005366 Unclassified 1741
10 Ga0070709_10334499 3300005434 Bacteria 1115
11 Ga0070714_100876413 3300005435 Bacteria 871
12 Ga0070713_100225578 3300005436 Bacteria 1701
13 Ga0070713_100802798 3300005436 Bacteria 902
14 Ga0070713_100863692 3300005436 Bacteria 869
15 Ga0070710_11188661 3300005437 Unclassified 563
16 Ga0070701_11335929 3300005438 Unclassified 513
17 Ga0070711_100040033 3300005439 Bacteria 3159
18 Ga0070663_100216340 3300005455 Bacteria 1502
19 Ga0070678_100068349 3300005456 Unclassified 2648
20 Ga0070678_100136901 3300005456 Bacteria 1954
21 Ga0070662_100309750 3300005457 Unclassified 1285
22 Ga0070681_10438134 3300005458 Unclassified 1219
23 Ga0068853_100011768 3300005539 Bacteria 7112
24 Ga0068853_101118176 3300005539 Bacteria 760
25 Ga0070665_100045712 3300005548 Bacteria 4397
26 Ga0068855_100099948 3300005563 Unclassified 3341
27 Ga0070664_100060225 3300005564 Bacteria 3232
28 Ga0068854_100154258 3300005578 Bacteria 1773
29 Ga0068856_100031929 3300005614 Bacteria 5153
30 Ga0068856_100033030 3300005614 Bacteria 5068
31 Ga0068856_100039488 3300005614 Bacteria 4634
32 Ga0068852_101233410 3300005616 Bacteria 769
33 Ga0068859_101590064 3300005617 Unclassified 722
34 Ga0068858_100232729 3300005842 Bacteria 1747
35 Ga0081540_1130396 3300005983 Bacteria 1027
36 Ga0070717_10020001 3300006028 Bacteria 5258
37 Ga0070717_11714505 3300006028 Unclassified 568
38 Ga0068871_100444393 3300006358 Bacteria 1161
39 Ga0075436_100823647 3300006914 Bacteria 692
40 Ga0097620_101590203 3300006931 Unclassified 722
41 Ga0105245_10291418 3300009098 Bacteria 1599
42 Ga0105245_10564421 3300009098 Bacteria 1161
43 Ga0105243_10975425 3300009148 Bacteria 848
44 Ga0105241_10083745 3300009174 Bacteria 2503
45 Ga0105242_10306858 3300009176 Bacteria 1451
46 Ga0105242_10712666 3300009176 Bacteria 983
47 Ga0105237_10550736 3300009545 Unclassified 1160
48 Ga0105238_11549408 3300009551 Unclassified 692
49 Ga0105239_10865158 3300010375 Bacteria 1037
50 Ga0157373_10118743 3300013100 Unclassified 1859
51 Ga0157373_10773283 3300013100 Unclassified 707
52 Ga0157371_10127810 3300013102 Unclassified 1807
53 Ga0157370_10458274 3300013104 Unclassified 1172
54 Ga0157369_10002641 3300013105 Bacteria 21400
55 Ga0157369_10085806 3300013105 Bacteria 3363
56 Ga0157369_10527948 3300013105 Bacteria 1221
57 Ga0157374_10006628 3300013296 Bacteria 9841
58 Ga0157374_10063185 3300013296 Bacteria 3472
59 Ga0157374_10141172 3300013296 Bacteria 2338
60 Ga0163162_11780614 3300013306 Unclassified 704
61 Ga0157372_10171910 3300013307 Bacteria 2507
62 Ga0157375_10174289 3300013308 Bacteria 2300
63 Ga0163163_10324387 3300014325 Bacteria 1594
64 Ga0182008_10282826 3300014497 Bacteria 864
65 Ga0157376_10017173 3300014969 Bacteria 5512
66 Ga0157376_11457055 3300014969 Bacteria 717
67 Ga0213873_10009735 3300021358 Bacteria 2005
68 Ga0213873_10018075 3300021358 Bacteria 1617
69 Ga0213873_10041034 3300021358 Bacteria 1192
70 Ga0213872_10000310 3300021361 Bacteria 41619
71 Ga0213874_10015417 3300021377 Bacteria 2016
72 Ga0213874_10096864 3300021377 Unclassified 976
73 Ga0213876_10000901 3300021384 Bacteria 19804
74 Ga0213876_10055164 3300021384 Unclassified 2098
75 Ga0213876_10300855 3300021384 Unclassified 853
76 Ga0213875_10000008 3300021388 Bacteria 533344
77 Ga0213875_10000029 3300021388 Bacteria 182973
78 Ga0213875_10018325 3300021388 Bacteria 3375
79 Ga0213875_10024205 3300021388 Bacteria 2897
80 Ga0213875_10027819 3300021388 Bacteria 2690
81 Ga0213875_10188514 3300021388 Bacteria 969
82 Ga0213875_10232721 3300021388 Bacteria 868
83 Ga0213875_10275856 3300021388 Bacteria 794
84 Ga0213871_10000131 3300021441 Bacteria 7492
85 Ga0207692_10429755 3300025898 Bacteria 828
86 Ga0207647_10215608 3300025904 Bacteria 1107
87 Ga0207654_10151711 3300025911 Bacteria 1488
88 Ga0207707_10756863 3300025912 Bacteria 812
89 Ga0207693_10897492 3300025915 Bacteria 680
90 Ga0207663_10283931 3300025916 Bacteria 1230
91 Ga0207657_10065604 3300025919 Unclassified 3094
92 Ga0207649_10157253 3300025920 Bacteria 1572
93 Ga0207687_10066516 3300025927 Bacteria 2562
94 Ga0207687_10215192 3300025927 Unclassified 1509
95 Ga0207700_10431047 3300025928 Bacteria 1159
96 Ga0207664_10775110 3300025929 Bacteria 863
97 Ga0207690_10023891 3300025932 Unclassified 3822
98 Ga0207706_10234138 3300025933 Bacteria 1606
99 Ga0207686_10016734 3300025934 Bacteria 4118
100 Ga0207686_10405123 3300025934 Bacteria 1040
101 Ga0207679_10050826 3300025945 Bacteria 3031
102 Ga0207667_10081746 3300025949 Unclassified 3347
103 Ga0207703_10119832 3300026035 Bacteria 2258
104 Ga0207639_10014606 3300026041 Bacteria 5530
105 Ga0207678_10009647 3300026067 Bacteria 8489
106 Ga0207678_10376023 3300026067 Unclassified 1228
107 Ga0207702_10029098 3300026078 Bacteria 4595
108 Ga0207702_10285688 3300026078 Bacteria 1561
109 Ga0207702_11941777 3300026078 Unclassified 579
110 Ga0207683_10165072 3300026121 Bacteria 2003
111 Ga0268266_10009626 3300028379 Bacteria 8499
112 Ga0373945_0257694 3300035116 Unclassified 738
113 Ga0373935_0252997 3300035692 Bacteria 1233
114 Ga0373927_0173269 3300035695 Bacteria 1415
115 Ga0373933_1121618 3300035724 Unclassified 518
116 Ga0373947_0332147 3300035725 Bacteria 1018
117 Ga0436364_0012365 3300037853 Bacteria 1070
118 Ga0436364_0063756 3300037853 Bacteria 11859
119 Ga0436364_0102138 3300037853 Bacteria 1099
120 Ga0436364_0116052 3300037853 Bacteria 3268
121 Ga0436364_0250455 3300037853 Bacteria 1374
122 Ga0436364_0265488 3300037853 Bacteria 17133
123 Ga0436364_0296334 3300037853 Bacteria 1387
124 Ga0436364_0296443 3300037853 Bacteria 9868
125 Ga0436364_0364416 3300037853 Bacteria 84577
126 Ga0436364_0456766 3300037853 Bacteria 3567
127 Ga0436364_0761985 3300037853 Bacteria 1041
128 Ga0436364_0901888 3300037853 Unclassified 696
129 Ga0436364_0988958 3300037853 Bacteria 2971
130 Ga0436364_1103790 3300037853 Bacteria 4341
131 Ga0436364_1167050 3300037853 Bacteria 3481
132 Ga0436364_1248777 3300037853 Bacteria 1944
133 Ga0436364_1357407 3300037853 Bacteria 752
134 Ga0436364_1415525 3300037853 Bacteria 425173
135 Ga0436364_1490374 3300037853 Bacteria 10881
136 Ga0436364_1533750 3300037853 Bacteria 854
137 Ga0436365_0115117 3300039437 Bacteria 883
138 Ga0436365_0382589 3300039437 Bacteria 5840
139 Ga0436365_0561139 3300039437 Unclassified 534
140 Ga0436365_0712906 3300039437 Unclassified 1253
141 Ga0436365_0918619 3300039437 Bacteria 2671
142 Ga0436365_0961691 3300039437 Bacteria 1390
143 Ga0436365_0969494 3300039437 Bacteria 1013
144 Ga0436365_1115146 3300039437 Bacteria 1474
145 Ga0436365_1329864 3300039437 Bacteria 1128
146 Ga0436365_1568830 3300039437 Unclassified 664
147 Ga0436365_1758695 3300039437 Bacteria 820
148 Ga0436365_1786527 3300039437 Bacteria 1116
149 Ga0436365_1898618 3300039437 Bacteria 1196
150 Ga0436360_0053971 3300039438 Bacteria 38094
151 Ga0436360_0225965 3300039438 Unclassified 578
152 Ga0436360_0414270 3300039438 Bacteria 2534
153 Ga0436360_0649255 3300039438 Bacteria 1079
154 Ga0436360_1199080 3300039438 Bacteria 2124
155 Ga0436361_0454518 3300039447 Bacteria 30587
156 Ga0436361_0623164 3300039447 Bacteria 2143
157 Ga0436363_0142474 3300039450 Bacteria 3338
158 Ga0436363_0275231 3300039450 Bacteria 2210
159 Ga0436363_0818776 3300039450 Bacteria 877
160 Ga0436363_0875043 3300039450 Unclassified 757
161 Ga0436363_0927997 3300039450 Bacteria 707
162 Ga0436363_1291489 3300039450 Bacteria 3427
163 Ga0436363_1445329 3300039450 Unclassified 693
164 Ga0436363_1474879 3300039450 Unclassified 1519
165 Ga0436363_1493489 3300039450 Bacteria 1120
166 Ga0436362_0347596 3300039453 Bacteria 1710
167 Ga0436362_0473835 3300039453 Bacteria 917
168 Ga0436362_0620340 3300039453 Bacteria 8113
169 Ga0436362_0682056 3300039453 Bacteria 2344
170 Ga0436362_0697991 3300039453 Bacteria 3727
171 Ga0436362_0854797 3300039453 Bacteria 2800
172 Ga0436362_1150560 3300039453 Bacteria 696
173 Ga0466966_0378695 3300044684 Bacteria 850
174 Ga0466966_0536862 3300044684 Bacteria 704
175 Ga0466961_0090630 3300044693 Bacteria 1931
176 Ga0466963_0072773 3300044694 Bacteria 2316
177 Ga0466963_0450066 3300044694 Bacteria 909
178 Ga0466963_0564485 3300044694 Bacteria 804
179 Ga0466958_0292577 3300045836 Bacteria 1045
180 Ga0466967_0286791 3300045976 Bacteria 1581
181 Ga0466967_0521273 3300045976 Bacteria 1168
182 Ga0466967_1139268 3300045976 Bacteria 777
183 Ga0466967_1241060 3300045976 Bacteria 742
184 Ga0466967_1464785 3300045976 Unclassified 680
185 Ga0496107_0703735 3300048910 Bacteria 743
186 Ga0496109_1149426 3300048912 Bacteria 713
187 Ga0496112_0033677 3300048915 Bacteria 4981
188 Ga0496113_0159834 3300048916 Unclassified 1781
189 Ga0496115_0070299 3300048918 Unclassified 2838
190 Ga0496126_0676235 3300048929 Bacteria 805
191 Ga0587083_0180169 3300059505 Unclassified 591
192 Ga0466962_0199411 3300061719 Bacteria 978
193 Ga0213875_10002616
194 JGI24737J22298_10151356
195 Ga0070660_100049384
196 Ga0070660_100954126
197 Ga0070689_100521570
198 Ga0070661_100194381
199 Ga0070688_100287315
200 Ga0070659_100089331
201 Ga0070659_100178621
202 Ga0070709_10334499
203 Ga0070714_100876413
204 Ga0070713_100225578
205 Ga0070713_100802798
206 Ga0070713_100863692
207 Ga0070710_11188661
208 Ga0070701_11335929
209 Ga0070711_100040033
210 Ga0070663_100216340
211 Ga0070678_100068349
212 Ga0070678_100136901
213 Ga0070662_100309750
214 Ga0070681_10438134
215 Ga0068853_100011768
216 Ga0068853_101118176
217 Ga0070665_100045712
218 Ga0068855_100099948
219 Ga0070664_100060225
220 Ga0068854_100154258
221 Ga0068856_100031929
222 Ga0068856_100033030
223 Ga0068856_100039488
224 Ga0068852_101233410
225 Ga0068859_101590064
226 Ga0068858_100232729
227 Ga0081540_1130396
228 Ga0070717_10020001
229 Ga0070717_11714505
230 Ga0068871_100444393
231 Ga0075436_100823647
232 Ga0097620_101590203
233 Ga0105245_10291418
234 Ga0105245_10564421
235 Ga0105243_10975425
236 Ga0105241_10083745
237 Ga0105242_10306858
238 Ga0105242_10712666
239 Ga0105237_10550736
240 Ga0105238_11549408
241 Ga0105239_10865158
242 Ga0157373_10118743
243 Ga0157373_10773283
244 Ga0157371_10127810
245 Ga0157370_10458274
246 Ga0157369_10002641
247 Ga0157369_10085806
248 Ga0157369_10527948
249 Ga0157374_10006628
250 Ga0157374_10063185
251 Ga0157374_10141172
252 Ga0163162_11780614
253 Ga0157372_10171910
254 Ga0157375_10174289
255 Ga0163163_10324387
256 Ga0182008_10282826
257 Ga0157376_10017173
258 Ga0157376_11457055
259 Ga0213873_10009735
260 Ga0213873_10018075
261 Ga0213873_10041034
262 Ga0213872_10000310
263 Ga0213874_10015417
264 Ga0213874_10096864
265 Ga0213876_10000901
266 Ga0213876_10055164
267 Ga0213876_10300855
268 Ga0213875_10000008
269 Ga0213875_10000029
270 Ga0213875_10018325
271 Ga0213875_10024205
272 Ga0213875_10027819
273 Ga0213875_10188514
274 Ga0213875_10232721
275 Ga0213875_10275856
276 Ga0213871_10000131
277 Ga0207692_10429755
278 Ga0207647_10215608
279 Ga0207654_10151711
280 Ga0207707_10756863
281 Ga0207693_10897492
282 Ga0207663_10283931
283 Ga0207657_10065604
284 Ga0207649_10157253
285 Ga0207687_10066516
286 Ga0207687_10215192
287 Ga0207700_10431047
288 Ga0207664_10775110
289 Ga0207690_10023891
290 Ga0207706_10234138
291 Ga0207686_10016734
292 Ga0207686_10405123
293 Ga0207679_10050826
294 Ga0207667_10081746
295 Ga0207703_10119832
296 Ga0207639_10014606
297 Ga0207678_10009647
298 Ga0207678_10376023
299 Ga0207702_10029098
300 Ga0207702_10285688
301 Ga0207702_11941777
302 Ga0207683_10165072
303 Ga0268266_10009626
304 Ga0373945_0257694
305 Ga0373935_0252997
306 Ga0373927_0173269
307 Ga0373933_1121618
308 Ga0373947_0332147
309 Ga0436364_0012365
310 Ga0436364_0063756
311 Ga0436364_0102138
312 Ga0436364_0116052
313 Ga0436364_0250455
314 Ga0436364_0265488
315 Ga0436364_0296334
316 Ga0436364_0296443
317 Ga0436364_0364416
318 Ga0436364_0456766
319 Ga0436364_0761985
320 Ga0436364_0901888
321 Ga0436364_0988958
322 Ga0436364_1103790
323 Ga0436364_1167050
324 Ga0436364_1248777
325 Ga0436364_1357407
326 Ga0436364_1415525
327 Ga0436364_1490374
328 Ga0436364_1533750
329 Ga0436365_0115117
330 Ga0436365_0382589
331 Ga0436365_0561139
332 Ga0436365_0712906
333 Ga0436365_0918619
334 Ga0436365_0961691
335 Ga0436365_0969494
336 Ga0436365_1115146
337 Ga0436365_1329864
338 Ga0436365_1568830
339 Ga0436365_1758695
340 Ga0436365_1786527
341 Ga0436365_1898618
342 Ga0436360_0053971
343 Ga0436360_0225965
344 Ga0436360_0414270
345 Ga0436360_0649255
346 Ga0436360_1199080
347 Ga0436361_0454518
348 Ga0436361_0623164
349 Ga0436363_0142474
350 Ga0436363_0275231
351 Ga0436363_0818776
352 Ga0436363_0875043
353 Ga0436363_0927997
354 Ga0436363_1291489
355 Ga0436363_1445329
356 Ga0436363_1474879
357 Ga0436363_1493489
358 Ga0436362_0347596
359 Ga0436362_0473835
360 Ga0436362_0620340
361 Ga0436362_0682056
362 Ga0436362_0697991
363 Ga0436362_0854797
364 Ga0436362_1150560
365 Ga0466966_0378695
366 Ga0466966_0536862
367 Ga0466961_0090630
368 Ga0466963_0072773
369 Ga0466963_0450066
370 Ga0466963_0564485
371 Ga0466958_0292577
372 Ga0466967_0286791
373 Ga0466967_0521273
374 Ga0466967_1139268
375 Ga0466967_1241060
376 Ga0466967_1464785
377 Ga0496107_0703735
378 Ga0496109_1149426
379 Ga0496112_0033677
380 Ga0496113_0159834
381 Ga0496115_0070299
382 Ga0496126_0676235
383 Ga0587083_0180169
384 Ga0466962_0199411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hil-assembly1.cif.gz_A crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine 0.6834 19 55
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.6796 37 58
5him-assembly1.cif.gz_A crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and dimethylglycine 0.6784 19 55
6s5z-assembly2.cif.gz_B structure of rib r28n from streptococcus pyogenes 0.6565 37 59
4aq1-assembly1.cif.gz_A structure of the sbsb s-layer protein of geobacillus stearothermophilus pv72p2 in complex with nanobody kb6 0.6535 37 59
ID Description Score Start End Superfamily
af_Q4DCU7_1_151_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7612 21 59 2.130.10.10
af_Q4CMB4_90_212_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7109 21 55 3.60.10.10
af_Q02487_472_572_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7049 19 59 2.60.40.60
1bzwA00 Mainly Beta;Sandwich;Jelly Rolls; 0.7025 16 55 2.60.120.200
af_Q08554_474_571_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.6882 19 57 2.60.40.60
ID Description Score Start End GO Terms
AF-A0A2U3L3T5-F1-model_v4 Uncharacterized protein 0.909 4 118
AF-A0A7C5AWZ4-F1-model_v4 Uncharacterized protein 0.9038 4 119
AF-A0A7V5YRF4-F1-model_v4 Uncharacterized protein 0.893 3 116
AF-A0A7C5AWZ4-F1-model_v4 Uncharacterized protein 0.8894 4 119
AF-A0A7C2ISS6-F1-model_v4 Uncharacterized protein 0.8853 1 118

Map