F295667

General Info

Members Datasets Scaffolds Average Seq Length
192 135 192 139

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_12146812|Ga0157372_121468122
Length 128
Sequence VSRALEPPADRDLVQQTFEPQPVHIDDNGHVNNVVYLRWAQDMGTGHWRSRVALRHEVDYRRELKLGETAFGRTWVADRAEGPRFNRYIRIDAQDGSMCAQVITTWVLIEQATGRPRRVPDWMMEMFG

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.81
Nodule 0
Rhizoplane 6.77
Rhizosphere 81.77
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F6ESG4R02IXOEY 2088090003 Bacteria 513
2 JGI25157J39369_1015639 3300002741 Bacteria 933
3 Ga0055530_10002837 3300003791 Bacteria 10598
4 Ga0055531_10004719 3300003794 Bacteria 8152
5 Ga0055531_10016968 3300003794 Bacteria 3104
6 Ga0065165_1000041 3300005262 Bacteria 203876
7 Ga0065165_1014074 3300005262 Bacteria 3124
8 Ga0070658_10101132 3300005327 Bacteria 2383
9 Ga0070683_100786771 3300005329 Bacteria 912
10 Ga0070690_101388072 3300005330 Bacteria 565
11 Ga0070670_101208292 3300005331 Bacteria 691
12 Ga0070670_102068368 3300005331 Unclassified 525
13 Ga0070677_10833506 3300005333 Bacteria 529
14 Ga0070666_11141532 3300005335 Bacteria 580
15 Ga0070680_100126499 3300005336 Bacteria 2135
16 Ga0068868_100069182 3300005338 Bacteria 2813
17 Ga0068868_102145142 3300005338 Bacteria 532
18 Ga0070660_100108817 3300005339 Bacteria 2203
19 Ga0070660_100281463 3300005339 Bacteria 1361
20 Ga0070660_101301215 3300005339 Bacteria 617
21 Ga0070689_101245757 3300005340 Bacteria 669
22 Ga0070671_100091072 3300005355 Bacteria 2553
23 Ga0070674_101019793 3300005356 Bacteria 727
24 Ga0070659_100011553 3300005366 Bacteria 6533
25 Ga0070667_101359078 3300005367 Unclassified 666
26 Ga0070678_101099316 3300005456 Unclassified 734
27 Ga0070662_100247121 3300005457 Bacteria 1433
28 Ga0070662_101491831 3300005457 Bacteria 583
29 Ga0070681_10038260 3300005458 Bacteria 4810
30 Ga0068867_102134062 3300005459 Bacteria 531
31 Ga0070698_100746338 3300005471 Bacteria 922
32 Ga0070679_100073462 3300005530 Bacteria 3411
33 Ga0068853_100232560 3300005539 Bacteria 1687
34 Ga0068853_101776854 3300005539 Bacteria 598
35 Ga0070672_100344738 3300005543 Bacteria 1269
36 Ga0070665_100000397 3300005548 Bacteria 64128
37 Ga0070665_100019268 3300005548 Bacteria 6845
38 Ga0068855_100015616 3300005563 Bacteria 9137
39 Ga0068855_100018740 3300005563 Bacteria 8322
40 Ga0070664_100208757 3300005564 Bacteria 1745
41 Ga0068856_100541158 3300005614 Bacteria 1186
42 Ga0068856_100643763 3300005614 Bacteria 1081
43 Ga0068852_101247241 3300005616 Bacteria 765
44 Ga0068864_100055554 3300005618 Bacteria 3419
45 Ga0068864_101282385 3300005618 Bacteria 733
46 Ga0068863_100509467 3300005841 Bacteria 1186
47 Ga0070717_10106908 3300006028 Bacteria 2383
48 Ga0075362_10208188 3300006177 Bacteria 953
49 Ga0097621_101211098 3300006237 Unclassified 711
50 Ga0105240_10022335 3300009093 Bacteria 8389
51 Ga0105240_10064377 3300009093 Bacteria 4556
52 Ga0105240_10400693 3300009093 Bacteria 1545
53 Ga0105240_10619017 3300009093 Bacteria 1190
54 Ga0105245_10407072 3300009098 Bacteria 1361
55 Ga0105241_10634399 3300009174 Bacteria 969
56 Ga0105242_11159494 3300009176 Bacteria 790
57 Ga0105248_10002557 3300009177 Bacteria 20245
58 Ga0105248_10186332 3300009177 Bacteria 2338
59 Ga0105237_10769027 3300009545 Bacteria 970
60 Ga0105237_10884506 3300009545 Bacteria 900
61 Ga0105238_10036113 3300009551 Bacteria 5024
62 Ga0105238_10055303 3300009551 Bacteria 3984
63 Ga0105238_10267821 3300009551 Bacteria 1689
64 Ga0105238_11816885 3300009551 Bacteria 642
65 Ga0105249_10282185 3300009553 Bacteria 1659
66 Ga0105249_12202824 3300009553 Bacteria 624
67 Ga0105239_11635037 3300010375 Bacteria 745
68 Ga0105239_12038632 3300010375 Bacteria 666
69 Ga0105246_12109590 3300011119 Bacteria 546
70 Ga0157370_10388771 3300013104 Bacteria 1284
71 Ga0157369_10263009 3300013105 Bacteria 1799
72 Ga0157374_10915670 3300013296 Bacteria 895
73 Ga0157378_11541944 3300013297 Bacteria 709
74 Ga0163162_10254196 3300013306 Bacteria 1889
75 Ga0163162_10413433 3300013306 Bacteria 1481
76 Ga0157372_12146812 3300013307 Bacteria 642
77 Ga0157375_10084432 3300013308 Bacteria 3224
78 Ga0157375_13440535 3300013308 Bacteria 527
79 Ga0163163_10119030 3300014325 Bacteria 2674
80 Ga0163163_10168445 3300014325 Bacteria 2237
81 Ga0163163_10227775 3300014325 Bacteria 1913
82 Ga0209026_1001465 3300025250 Bacteria 10416
83 Ga0209758_1000555 3300025297 Bacteria 59166
84 Ga0209050_1000034 3300025298 Bacteria 433906
85 Ga0209257_1000052 3300025304 Bacteria 430947
86 Ga0209257_1000100 3300025304 Bacteria 253399
87 Ga0209257_1000618 3300025304 Bacteria 57657
88 Ga0207680_10720674 3300025903 Bacteria 715
89 Ga0207705_10035157 3300025909 Bacteria 3584
90 Ga0207705_10190268 3300025909 Bacteria 1551
91 Ga0207707_10078946 3300025912 Bacteria 2874
92 Ga0207695_10001430 3300025913 Bacteria 40141
93 Ga0207695_10001687 3300025913 Bacteria 35481
94 Ga0207695_10040528 3300025913 Bacteria 4991
95 Ga0207695_11197666 3300025913 Bacteria 640
96 Ga0207671_10709269 3300025914 Bacteria 800
97 Ga0207660_10002013 3300025917 Bacteria 13517
98 Ga0207657_10012407 3300025919 Bacteria 8420
99 Ga0207657_10231471 3300025919 Bacteria 1478
100 Ga0207649_10361184 3300025920 Bacteria 1078
101 Ga0207652_10015469 3300025921 Bacteria 6202
102 Ga0207694_10035042 3300025924 Bacteria 3849
103 Ga0207694_10039770 3300025924 Bacteria 3619
104 Ga0207694_10830655 3300025924 Bacteria 781
105 Ga0207650_11891898 3300025925 Unclassified 504
106 Ga0207687_10347437 3300025927 Bacteria 1208
107 Ga0207644_10119385 3300025931 Bacteria 2005
108 Ga0207690_10005345 3300025932 Bacteria 7568
109 Ga0207690_10011080 3300025932 Bacteria 5378
110 Ga0207706_11220521 3300025933 Bacteria 624
111 Ga0207691_10164359 3300025940 Bacteria 1945
112 Ga0207711_10001318 3300025941 Bacteria 23485
113 Ga0207711_10136567 3300025941 Bacteria 2203
114 Ga0207679_10170059 3300025945 Bacteria 1793
115 Ga0207667_10042898 3300025949 Bacteria 4804
116 Ga0207667_10088969 3300025949 Bacteria 3192
117 Ga0207712_10405734 3300025961 Bacteria 1146
118 Ga0207658_11601534 3300025986 Bacteria 595
119 Ga0207639_10109282 3300026041 Bacteria 2250
120 Ga0207678_10676691 3300026067 Bacteria 907
121 Ga0207702_11418418 3300026078 Bacteria 688
122 Ga0207641_10140717 3300026088 Bacteria 2177
123 Ga0207676_10153424 3300026095 Bacteria 1986
124 Ga0207676_10366384 3300026095 Bacteria 1337
125 Ga0207676_10368412 3300026095 Bacteria 1334
126 Ga0207676_11245667 3300026095 Bacteria 738
127 Ga0207674_10102677 3300026116 Bacteria 2839
128 Ga0207675_100825076 3300026118 Bacteria 941
129 Ga0207683_10091755 3300026121 Bacteria 2706
130 Ga0207683_11370844 3300026121 Bacteria 654
131 Ga0268266_10000062 3300028379 Bacteria 253490
132 Ga0268266_10200459 3300028379 Bacteria 1826
133 Ga0268265_10299235 3300028380 Bacteria 1448
134 Ga0307517_10039268 3300028786 Bacteria 5205
135 Ga0307517_10162789 3300028786 Bacteria 1492
136 Ga0307517_10192088 3300028786 Bacteria 1294
137 Ga0307511_10082979 3300030521 Bacteria 2236
138 Ga0307513_10053242 3300031456 Bacteria 4352
139 Ga0307413_10577056 3300031824 Bacteria 917
140 Ga0307414_10850058 3300032004 Bacteria 834
141 Ga0307414_12025200 3300032004 Bacteria 537
142 Ga0395898_1792138 3300037466 Bacteria 535
143 Ga0395905_0278303 3300037471 Bacteria 1559
144 Ga0395905_0291078 3300037471 Bacteria 1520
145 Ga0395905_1384822 3300037471 Bacteria 607
146 Ga0395905_1490953 3300037471 Bacteria 581
147 Ga0439436_0148165 3300041404 Bacteria 661
148 Ga0439442_071012 3300042002 Bacteria 742
149 Ga0439446_0211427 3300042156 Bacteria 658
150 Ga0466960_0420072 3300044901 Bacteria 773
151 Ga0495638_0402395 3300046460 Bacteria 710
152 Ga0495650_0027516 3300046471 Bacteria 2625
153 Ga0495648_0435870 3300046524 Bacteria 577
154 Ga0495642_0138323 3300046528 Bacteria 1050
155 Ga0495597_0244442 3300046542 Bacteria 707
156 Ga0495668_0218251 3300046616 Bacteria 1044
157 Ga0495625_0407220 3300046660 Bacteria 848
158 Ga0495647_0144207 3300046681 Bacteria 1017
159 Ga0495669_0009492 3300046684 Bacteria 4104
160 Ga0495669_0353617 3300046684 Bacteria 710
161 Ga0495670_0786526 3300046691 Bacteria 519
162 Ga0495672_0226743 3300047320 Bacteria 919
163 Ga0495677_0079607 3300047445 Bacteria 1227
164 Ga0495685_228011 3300047447 Bacteria 593
165 Ga0495686_0041698 3300047472 Bacteria 2921
166 Ga0496100_0376062 3300048903 Bacteria 1078
167 Ga0496101_0171754 3300048904 Bacteria 1666
168 Ga0496102_0052840 3300048905 Bacteria 3703
169 Ga0496107_0240427 3300048910 Bacteria 1347
170 Ga0496107_1138090 3300048910 Bacteria 563
171 Ga0496108_0056650 3300048911 Bacteria 3294
172 Ga0496109_0096932 3300048912 Bacteria 2733
173 Ga0496113_0492695 3300048916 Bacteria 984
174 Ga0496115_0002796 3300048918 Bacteria 12540
175 Ga0496115_0022168 3300048918 Bacteria 4916
176 Ga0496115_0308332 3300048918 Bacteria 1296
177 Ga0496115_0442625 3300048918 Bacteria 1051
178 Ga0496115_0918454 3300048918 Bacteria 674
179 Ga0501032_0712529 3300049569 Bacteria 636
180 Ga0501034_0857944 3300049571 Bacteria 798
181 Ga0501038_1195205 3300049574 Bacteria 552
182 Ga0501047_0002345 3300049581 Bacteria 18110
183 Ga0501047_0177836 3300049581 Bacteria 1995
184 Ga0501047_0325491 3300049581 Bacteria 1376
185 Ga0501071_1264540 3300049587 Bacteria 570
186 Ga0501080_0477537 3300049742 Bacteria 1116
187 Ga0501035_0368169 3300049822 Bacteria 1200
188 Ga0501044_0213562 3300049823 Bacteria 1882
189 nmdc:mga03n38_214521_c1 3300050490 Bacteria 1002
190 Ga0500641_0048501 3300053096 Bacteria 1740
191 Ga0500562_002340 3300053108 Bacteria 4761
192 Ga0500645_003553 3300053730 Bacteria 6286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0918454 Ga0496115_0918454_147_521 119
2 3300013307 Ga0157372_12146812 Ga0157372_121468122 128
3 3300009553 Ga0105249_12202824 Ga0105249_122028242 135
4 3300005329 Ga0070683_100786771 Ga0070683_1007867712 138
5 3300005330 Ga0070690_101388072 Ga0070690_1013880721 138
6 3300005331 Ga0070670_102068368 Ga0070670_1020683681 138
7 3300005335 Ga0070666_11141532 Ga0070666_111415321 138
8 3300005336 Ga0070680_100126499 Ga0070680_1001264992 138
9 3300005338 Ga0068868_100069182 Ga0068868_1000691825 138
10 3300005339 Ga0070660_101301215 Ga0070660_1013012151 138
11 3300005355 Ga0070671_100091072 Ga0070671_1000910723 138
12 3300005367 Ga0070667_101359078 Ga0070667_1013590781 138
13 3300005456 Ga0070678_101099316 Ga0070678_1010993162 138
14 3300005457 Ga0070662_100247121 Ga0070662_1002471213 138
15 3300005458 Ga0070681_10038260 Ga0070681_100382606 138
16 3300005459 Ga0068867_102134062 Ga0068867_1021340621 138
17 3300005539 Ga0068853_101776854 Ga0068853_1017768541 138
18 3300005543 Ga0070672_100344738 Ga0070672_1003447383 138
19 3300005548 Ga0070665_100019268 Ga0070665_10001926810 138
20 3300005563 Ga0068855_100018740 Ga0068855_1000187408 138
21 3300005564 Ga0070664_100208757 Ga0070664_1002087573 138
22 3300005614 Ga0068856_100643763 Ga0068856_1006437632 138
23 3300005618 Ga0068864_100055554 Ga0068864_1000555544 138
24 3300005618 Ga0068864_101282385 Ga0068864_1012823852 138
25 3300005841 Ga0068863_100509467 Ga0068863_1005094672 138
26 3300006028 Ga0070717_10106908 Ga0070717_101069085 138
27 3300006237 Ga0097621_101211098 Ga0097621_1012110981 138
28 3300009093 Ga0105240_10022335 Ga0105240_100223356 138
29 3300009093 Ga0105240_10400693 Ga0105240_104006932 138
30 3300009098 Ga0105245_10407072 Ga0105245_104070723 138
31 3300009177 Ga0105248_10186332 Ga0105248_101863324 138
32 3300009551 Ga0105238_11816885 Ga0105238_118168851 138
33 3300009553 Ga0105249_10282185 Ga0105249_102821852 138
34 3300013104 Ga0157370_10388771 Ga0157370_103887712 138
35 3300013306 Ga0163162_10254196 Ga0163162_102541964 138
36 3300013306 Ga0163162_10413433 Ga0163162_104134334 138
37 3300013308 Ga0157375_10084432 Ga0157375_100844322 138
38 3300013308 Ga0157375_13440535 Ga0157375_134405351 138
39 3300014325 Ga0163163_10119030 Ga0163163_101190303 138
40 3300014325 Ga0163163_10168445 Ga0163163_101684453 138
41 3300014325 Ga0163163_10227775 Ga0163163_102277754 138
42 3300025903 Ga0207680_10720674 Ga0207680_107206742 138
43 3300025913 Ga0207695_10001430 Ga0207695_1000143013 138
44 3300025913 Ga0207695_10001687 Ga0207695_1000168720 138
45 3300025925 Ga0207650_11891898 Ga0207650_118918981 138
46 3300025927 Ga0207687_10347437 Ga0207687_103474373 138
47 3300025931 Ga0207644_10119385 Ga0207644_101193852 138
48 3300025940 Ga0207691_10164359 Ga0207691_101643594 138
49 3300025941 Ga0207711_10136567 Ga0207711_101365675 138
50 3300025945 Ga0207679_10170059 Ga0207679_101700594 138
51 3300025949 Ga0207667_10042898 Ga0207667_100428986 138
52 3300025961 Ga0207712_10405734 Ga0207712_104057343 138
53 3300025986 Ga0207658_11601534 Ga0207658_116015341 138
54 3300026041 Ga0207639_10109282 Ga0207639_101092824 138
55 3300026067 Ga0207678_10676691 Ga0207678_106766912 138
56 3300026088 Ga0207641_10140717 Ga0207641_101407173 138
57 3300026095 Ga0207676_10153424 Ga0207676_101534243 138
58 3300026095 Ga0207676_10366384 Ga0207676_103663841 138
59 3300026095 Ga0207676_10368412 Ga0207676_103684121 138
60 3300026116 Ga0207674_10102677 Ga0207674_101026775 138
61 3300026121 Ga0207683_10091755 Ga0207683_100917555 138
62 3300028379 Ga0268266_10200459 Ga0268266_102004594 138
63 3300028786 Ga0307517_10039268 Ga0307517_100392682 138
64 3300028786 Ga0307517_10192088 Ga0307517_101920882 138
65 3300031456 Ga0307513_10053242 Ga0307513_100532427 138
66 3300046460 Ga0495638_0402395 Ga0495638_0402395_135_551 138
67 3300046524 Ga0495648_0435870 Ga0495648_0435870_80_496 138
68 3300046528 Ga0495642_0138323 Ga0495642_0138323_528_944 138
69 3300046542 Ga0495597_0244442 Ga0495597_0244442_140_556 138
70 3300046660 Ga0495625_0407220 Ga0495625_0407220_412_828 138
71 3300046684 Ga0495669_0009492 Ga0495669_0009492_394_810 138
72 3300046684 Ga0495669_0353617 Ga0495669_0353617_227_643 138
73 3300046691 Ga0495670_0786526 Ga0495670_0786526_58_474 138
74 3300047320 Ga0495672_0226743 Ga0495672_0226743_112_528 138
75 3300047445 Ga0495677_0079607 Ga0495677_0079607_145_561 138
76 3300047447 Ga0495685_228011 Ga0495685_228011_55_471 138
77 3300048903 Ga0496100_0376062 Ga0496100_0376062_93_509 138
78 3300048904 Ga0496101_0171754 Ga0496101_0171754_633_1049 138
79 3300048905 Ga0496102_0052840 Ga0496102_0052840_95_511 138
80 3300048910 Ga0496107_0240427 Ga0496107_0240427_184_600 138
81 3300048910 Ga0496107_1138090 Ga0496107_1138090_50_466 138
82 3300048911 Ga0496108_0056650 Ga0496108_0056650_1834_2250 138
83 3300048912 Ga0496109_0096932 Ga0496109_0096932_748_1164 138
84 3300048916 Ga0496113_0492695 Ga0496113_0492695_509_925 138
85 3300048918 Ga0496115_0002796 Ga0496115_0002796_7467_7883 138
86 3300048918 Ga0496115_0442625 Ga0496115_0442625_315_731 138
87 3300053096 Ga0500641_0048501 Ga0500641_0048501_1269_1685 138
88 3300002741 JGI25157J39369_1015639 JGI25157J39369_10156391 139
89 3300003791 Ga0055530_10002837 Ga0055530_1000283712 139
90 3300003794 Ga0055531_10004719 Ga0055531_100047194 139
91 3300003794 Ga0055531_10016968 Ga0055531_100169686 139
92 3300005262 Ga0065165_1000041 Ga0065165_100004126 139
93 3300005262 Ga0065165_1014074 Ga0065165_10140746 139
94 3300005327 Ga0070658_10101132 Ga0070658_101011324 139
95 3300005331 Ga0070670_101208292 Ga0070670_1012082921 139
96 3300005333 Ga0070677_10833506 Ga0070677_108335061 139
97 3300005338 Ga0068868_102145142 Ga0068868_1021451421 139
98 3300005339 Ga0070660_100108817 Ga0070660_1001088174 139
99 3300005339 Ga0070660_100281463 Ga0070660_1002814631 139
100 3300005340 Ga0070689_101245757 Ga0070689_1012457571 139
101 3300005356 Ga0070674_101019793 Ga0070674_1010197931 139
102 3300005366 Ga0070659_100011553 Ga0070659_1000115536 139
103 3300005457 Ga0070662_101491831 Ga0070662_1014918311 139
104 3300005471 Ga0070698_100746338 Ga0070698_1007463381 139
105 3300005530 Ga0070679_100073462 Ga0070679_1000734622 139
106 3300005539 Ga0068853_100232560 Ga0068853_1002325602 139
107 3300005548 Ga0070665_100000397 Ga0070665_10000039721 139
108 3300005563 Ga0068855_100015616 Ga0068855_1000156162 139
109 3300005614 Ga0068856_100541158 Ga0068856_1005411582 139
110 3300005616 Ga0068852_101247241 Ga0068852_1012472412 139
111 3300006177 Ga0075362_10208188 Ga0075362_102081881 139
112 3300009093 Ga0105240_10064377 Ga0105240_100643772 139
113 3300009093 Ga0105240_10619017 Ga0105240_106190172 139
114 3300009174 Ga0105241_10634399 Ga0105241_106343992 139
115 3300009176 Ga0105242_11159494 Ga0105242_111594942 139
116 3300009177 Ga0105248_10002557 Ga0105248_1000255711 139
117 3300009545 Ga0105237_10769027 Ga0105237_107690271 139
118 3300009545 Ga0105237_10884506 Ga0105237_108845062 139
119 3300009551 Ga0105238_10036113 Ga0105238_100361134 139
120 3300009551 Ga0105238_10055303 Ga0105238_100553037 139
121 3300009551 Ga0105238_10267821 Ga0105238_102678212 139
122 3300010375 Ga0105239_11635037 Ga0105239_116350372 139
123 3300010375 Ga0105239_12038632 Ga0105239_120386322 139
124 3300011119 Ga0105246_12109590 Ga0105246_121095902 139
125 3300013105 Ga0157369_10263009 Ga0157369_102630092 139
126 3300013296 Ga0157374_10915670 Ga0157374_109156702 139
127 3300013297 Ga0157378_11541944 Ga0157378_115419442 139
128 3300025250 Ga0209026_1001465 Ga0209026_10014656 139
129 3300025297 Ga0209758_1000555 Ga0209758_100055540 139
130 3300025298 Ga0209050_1000034 Ga0209050_1000034230 139
131 3300025304 Ga0209257_1000052 Ga0209257_1000052180 139
132 3300025304 Ga0209257_1000100 Ga0209257_100010045 139
133 3300025304 Ga0209257_1000618 Ga0209257_100061828 139
134 3300025909 Ga0207705_10035157 Ga0207705_100351573 139
135 3300025909 Ga0207705_10190268 Ga0207705_101902682 139
136 3300025912 Ga0207707_10078946 Ga0207707_100789463 139
137 3300025913 Ga0207695_10040528 Ga0207695_100405287 139
138 3300025913 Ga0207695_11197666 Ga0207695_111976661 139
139 3300025914 Ga0207671_10709269 Ga0207671_107092692 139
140 3300025917 Ga0207660_10002013 Ga0207660_100020139 139
141 3300025919 Ga0207657_10012407 Ga0207657_100124076 139
142 3300025919 Ga0207657_10231471 Ga0207657_102314712 139
143 3300025920 Ga0207649_10361184 Ga0207649_103611843 139
144 3300025921 Ga0207652_10015469 Ga0207652_100154694 139
145 3300025924 Ga0207694_10035042 Ga0207694_100350424 139
146 3300025924 Ga0207694_10039770 Ga0207694_100397703 139
147 3300025924 Ga0207694_10830655 Ga0207694_108306551 139
148 3300025932 Ga0207690_10005345 Ga0207690_100053454 139
149 3300025932 Ga0207690_10011080 Ga0207690_100110803 139
150 3300025933 Ga0207706_11220521 Ga0207706_112205212 139
151 3300025941 Ga0207711_10001318 Ga0207711_1000131812 139
152 3300025949 Ga0207667_10088969 Ga0207667_100889693 139
153 3300026078 Ga0207702_11418418 Ga0207702_114184181 139
154 3300026095 Ga0207676_11245667 Ga0207676_112456672 139
155 3300026118 Ga0207675_100825076 Ga0207675_1008250762 139
156 3300026121 Ga0207683_11370844 Ga0207683_113708442 139
157 3300028379 Ga0268266_10000062 Ga0268266_1000006294 139
158 3300028380 Ga0268265_10299235 Ga0268265_102992352 139
159 3300028786 Ga0307517_10162789 Ga0307517_101627892 139
160 3300030521 Ga0307511_10082979 Ga0307511_100829792 139
161 3300031824 Ga0307413_10577056 Ga0307413_105770561 139
162 3300032004 Ga0307414_10850058 Ga0307414_108500581 139
163 3300032004 Ga0307414_12025200 Ga0307414_120252001 139
164 3300037466 Ga0395898_1792138 Ga0395898_1792138_67_504 139
165 3300037471 Ga0395905_0278303 Ga0395905_0278303_579_998 139
166 3300037471 Ga0395905_0291078 Ga0395905_0291078_322_741 139
167 3300037471 Ga0395905_1384822 Ga0395905_1384822_174_593 139
168 3300037471 Ga0395905_1490953 Ga0395905_1490953_119_538 139
169 3300041404 Ga0439436_0148165 Ga0439436_0148165_183_602 139
170 3300042002 Ga0439442_071012 Ga0439442_071012_212_631 139
171 3300042156 Ga0439446_0211427 Ga0439446_0211427_113_532 139
172 3300044901 Ga0466960_0420072 Ga0466960_0420072_205_624 139
173 3300046471 Ga0495650_0027516 Ga0495650_0027516_1952_2371 139
174 3300046616 Ga0495668_0218251 Ga0495668_0218251_235_654 139
175 3300046681 Ga0495647_0144207 Ga0495647_0144207_230_649 139
176 3300047472 Ga0495686_0041698 Ga0495686_0041698_1925_2344 139
177 3300048918 Ga0496115_0022168 Ga0496115_0022168_1065_1496 139
178 3300048918 Ga0496115_0308332 Ga0496115_0308332_68_493 139
179 3300049569 Ga0501032_0712529 Ga0501032_0712529_168_587 139
180 3300049571 Ga0501034_0857944 Ga0501034_0857944_369_788 139
181 3300049574 Ga0501038_1195205 Ga0501038_1195205_99_518 139
182 3300049581 Ga0501047_0002345 Ga0501047_0002345_15471_15890 139
183 3300049581 Ga0501047_0177836 Ga0501047_0177836_775_1218 139
184 3300049581 Ga0501047_0325491 Ga0501047_0325491_200_619 139
185 3300049587 Ga0501071_1264540 Ga0501071_1264540_80_505 139
186 3300049742 Ga0501080_0477537 Ga0501080_0477537_82_501 139
187 3300049822 Ga0501035_0368169 Ga0501035_0368169_119_553 139
188 3300049823 Ga0501044_0213562 Ga0501044_0213562_1185_1628 139
189 3300050490 nmdc:mga03n38_214521_c1 nmdc:mga03n38_214521_c1_301_720 139
190 3300053108 Ga0500562_002340 Ga0500562_002340_2777_3196 139
191 3300053730 Ga0500645_003553 Ga0500645_003553_3790_4209 139
192 2088090003 LJN_F6ESG4R02IXOEY LJN_00036340 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

8

108

0.88

PF13279

4HBT_2

Thioesterase-like superfamily

20

127

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1psu-assembly1.cif.gz_A structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9152 16 121
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9056 18 139
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9016 17 124
2cye-assembly3.cif.gz_B crystal structure of thioesterase complexed with coenzyme a and zn from thermus thermophilus hb8 0.8984 18 141
5byu-assembly1.cif.gz_A crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.8965 18 139
ID Description Score Start End Superfamily
af_Q80ZW2_46_168_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9209 16 122 3.10.129.10
5eo2D01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9177 14 119 3.10.129.10
5eo2A01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9056 14 121 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9016 17 124 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8931 17 124 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1W9HDK4-F1-model_v4 Thioesterase 0.9777 17 141 GO:0016790
AF-A0A3N2QPA5-F1-model_v4 deleted 0.9771 16 141
AF-A0A7W9R972-F1-model_v4 deleted 0.976 14 141
AF-A0A7W9VDV9-F1-model_v4 deleted 0.9753 14 141
AF-A0A6I4TGQ1-F1-model_v4 Acyl-CoA thioesterase 0.9753 19 141 GO:0006633
GO:0016790

Feature Viewer

pLDDT pTM Quality
92.27 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map