F295433

General Info

Members Datasets Scaffolds Average Seq Length
192 143 384 138

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10007431|Ga0070717_100074318
Length 160
Sequence MLKHRDETMIRLNRIMVEEQSMKRSAAEIVREYGPFPGVDRVNGVTYDGQQVWFAAGDKLHALDPTSGKTLRAIDVASHAGGDSGLAWAEGTLWVGNRFVTGVTWVDDELWHATLEGDEMPPGVGVSGLESDGGDQFFCGGGSSGKVRAVRRPRAKARAK

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 3.12
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10007431 3300006028 Bacteria 8139
2 Ga0055524_1003389 3300003775 Bacteria 7754
3 Ga0065712_10069268 3300005290 Bacteria 7629
4 Ga0070658_10554286 3300005327 Bacteria 995
5 Ga0070690_100039548 3300005330 Bacteria 2979
6 Ga0070670_100097004 3300005331 Bacteria 2536
7 Ga0068869_100121206 3300005334 Bacteria 2000
8 Ga0070680_100037237 3300005336 Bacteria 3930
9 Ga0068868_100191646 3300005338 Bacteria 1700
10 Ga0070687_100101931 3300005343 Bacteria 1609
11 Ga0070671_100007199 3300005355 Bacteria 8896
12 Ga0070671_100563346 3300005355 Bacteria 983
13 Ga0070659_100127115 3300005366 Bacteria 2068
14 Ga0070667_100461136 3300005367 Bacteria 1162
15 Ga0070667_100486681 3300005367 Bacteria 1130
16 Ga0070714_100043222 3300005435 Bacteria 3810
17 Ga0070705_100072006 3300005440 Bacteria 2092
18 Ga0070700_100101377 3300005441 Bacteria 1897
19 Ga0070694_100002446 3300005444 Bacteria 10965
20 Ga0070663_100140145 3300005455 Bacteria 1845
21 Ga0070678_100635679 3300005456 Bacteria 956
22 Ga0070681_10537159 3300005458 Bacteria 1083
23 Ga0068867_100003365 3300005459 Bacteria 11262
24 Ga0070706_100008239 3300005467 Bacteria 9721
25 Ga0070698_100570167 3300005471 Bacteria 1072
26 Ga0070679_100289589 3300005530 Bacteria 1589
27 Ga0068853_100224141 3300005539 Bacteria 1718
28 Ga0068853_100976132 3300005539 Bacteria 815
29 Ga0070672_100038772 3300005543 Bacteria 3644
30 Ga0070672_100401807 3300005543 Bacteria 1174
31 Ga0070686_100038872 3300005544 Bacteria 2961
32 Ga0070693_100000154 3300005547 Bacteria 31511
33 Ga0068855_100131102 3300005563 Bacteria 2863
34 Ga0070664_100081567 3300005564 Bacteria 2788
35 Ga0070664_100101308 3300005564 Bacteria 2505
36 Ga0068854_100619373 3300005578 Bacteria 926
37 Ga0068856_100201889 3300005614 Bacteria 2003
38 Ga0068856_100714400 3300005614 Bacteria 1022
39 Ga0070702_100001093 3300005615 Bacteria 10844
40 Ga0070702_100112425 3300005615 Bacteria 1691
41 Ga0068859_100112842 3300005617 Bacteria 2782
42 Ga0068859_100140388 3300005617 Bacteria 2489
43 Ga0068859_100769961 3300005617 Bacteria 1051
44 Ga0068858_100005494 3300005842 Bacteria 12413
45 Ga0068858_100082493 3300005842 Bacteria 2989
46 Ga0068858_100166879 3300005842 Bacteria 2075
47 Ga0068860_100162951 3300005843 Bacteria 2151
48 Ga0068862_100079906 3300005844 Bacteria 2835
49 Ga0068862_100484598 3300005844 Bacteria 1171
50 Ga0081455_10001215 3300005937 Bacteria 32285
51 Ga0081455_10021693 3300005937 Bacteria 6017
52 Ga0081455_10064997 3300005937 Bacteria 3053
53 Ga0070715_10236475 3300006163 Bacteria 948
54 Ga0075367_10024754 3300006178 Bacteria 3386
55 Ga0075366_10184075 3300006195 Bacteria 1269
56 Ga0075370_10204554 3300006353 Bacteria 1165
57 Ga0068871_100201848 3300006358 Bacteria 1717
58 Ga0075428_100420293 3300006844 Bacteria 1432
59 Ga0075430_100070902 3300006846 Bacteria 2923
60 Ga0075433_10177250 3300006852 Bacteria 1897
61 Ga0075434_100493936 3300006871 Bacteria 1245
62 Ga0097620_100112842 3300006931 Bacteria 2782
63 Ga0097620_100140392 3300006931 Bacteria 2489
64 Ga0097620_100769964 3300006931 Bacteria 1051
65 Ga0075435_100044537 3300007076 Bacteria 3554
66 Ga0105240_10007360 3300009093 Bacteria 16015
67 Ga0105240_10015197 3300009093 Bacteria 10475
68 Ga0105240_10547617 3300009093 Bacteria 1281
69 Ga0111539_10016441 3300009094 Bacteria 9174
70 Ga0114129_10012284 3300009147 Bacteria 12184
71 Ga0114129_10064873 3300009147 Bacteria 5097
72 Ga0114129_10067701 3300009147 Bacteria 4979
73 Ga0114129_10072990 3300009147 Bacteria 4782
74 Ga0105243_10076277 3300009148 Bacteria 2723
75 Ga0105237_10005781 3300009545 Bacteria 13893
76 Ga0105238_10038091 3300009551 Bacteria 4884
77 Ga0105238_10408111 3300009551 Bacteria 1352
78 Ga0105249_10008874 3300009553 Bacteria 8782
79 Ga0105249_10588285 3300009553 Bacteria 1166
80 Ga0163162_10444252 3300013306 Bacteria 1429
81 Ga0157375_10179200 3300013308 Bacteria 2270
82 Ga0163163_10303531 3300014325 Bacteria 1649
83 Ga0157379_10299524 3300014968 Bacteria 1465
84 Ga0157379_10419252 3300014968 Bacteria 1232
85 Ga0157376_10446374 3300014969 Bacteria 1261
86 Ga0157376_10493246 3300014969 Bacteria 1202
87 Ga0213872_10036359 3300021361 Bacteria 2251
88 Ga0213872_10042372 3300021361 Bacteria 2076
89 Ga0213872_10064304 3300021361 Bacteria 1657
90 Ga0213876_10074437 3300021384 Bacteria 1794
91 Ga0213876_10128404 3300021384 Bacteria 1347
92 Ga0209256_1000064 3300025299 Bacteria 250853
93 Ga0207684_10005885 3300025910 Bacteria 11229
94 Ga0207695_10025511 3300025913 Bacteria 6614
95 Ga0207695_10030677 3300025913 Bacteria 5915
96 Ga0207671_10113494 3300025914 Bacteria 2064
97 Ga0207660_10033166 3300025917 Bacteria 3569
98 Ga0207662_10002400 3300025918 Bacteria 9397
99 Ga0207646_10005490 3300025922 Bacteria 13326
100 Ga0207694_10120727 3300025924 Bacteria 2093
101 Ga0207659_10005940 3300025926 Bacteria 7450
102 Ga0207700_10068568 3300025928 Bacteria 2719
103 Ga0207664_10143317 3300025929 Bacteria 2024
104 Ga0207644_10015081 3300025931 Bacteria 5184
105 Ga0207690_10095243 3300025932 Bacteria 2114
106 Ga0207709_10174600 3300025935 Bacteria 1511
107 Ga0207670_10080332 3300025936 Bacteria 2279
108 Ga0207691_10005645 3300025940 Bacteria 12094
109 Ga0207711_10017825 3300025941 Bacteria 5899
110 Ga0207689_10135402 3300025942 Bacteria 2028
111 Ga0207679_10124058 3300025945 Bacteria 2061
112 Ga0207651_10426032 3300025960 Bacteria 1134
113 Ga0207712_10095456 3300025961 Bacteria 2199
114 Ga0207712_10491866 3300025961 Bacteria 1047
115 Ga0207640_10177962 3300025981 Bacteria 1592
116 Ga0207658_10225853 3300025986 Bacteria 1578
117 Ga0207658_10273569 3300025986 Bacteria 1445
118 Ga0207703_10171481 3300026035 Bacteria 1909
119 Ga0207703_10221151 3300026035 Bacteria 1693
120 Ga0207639_10217837 3300026041 Bacteria 1647
121 Ga0207639_10384048 3300026041 Bacteria 1262
122 Ga0207639_10879190 3300026041 Bacteria 837
123 Ga0207678_10200000 3300026067 Bacteria 1708
124 Ga0207648_10144521 3300026089 Bacteria 2098
125 Ga0207675_100144202 3300026118 Bacteria 2264
126 Ga0207683_10341076 3300026121 Bacteria 1374
127 Ga0207428_10083421 3300027907 Bacteria 2492
128 Ga0268265_10272973 3300028380 Bacteria 1509
129 Ga0268265_10330215 3300028380 Bacteria 1385
130 Ga0268264_10179383 3300028381 Bacteria 1922
131 Ga0265338_10168632 3300028800 Bacteria 1682
132 Ga0265338_10212803 3300028800 Bacteria 1449
133 Ga0307509_10294836 3300031507 Bacteria 1374
134 Ga0307516_10038496 3300031730 Bacteria 4772
135 Ga0373923_0009317 3300035111 Bacteria 3540
136 Ga0373954_0109916 3300035118 Bacteria 1333
137 Ga0373943_0003012 3300035170 Bacteria 7650
138 Ga0373946_0003104 3300035171 Bacteria 5887
139 Ga0373955_0083447 3300035172 Bacteria 1810
140 Ga0373924_0017683 3300035410 Bacteria 2738
141 Ga0373927_0016845 3300035695 Bacteria 4819
142 Ga0373927_0542109 3300035695 Bacteria 769
143 Ga0373947_0133033 3300035725 Bacteria 1589
144 Ga0373937_0521597 3300036401 Bacteria 1129
145 Ga0373925_0013538 3300037068 Bacteria 5906
146 Ga0436365_0751647 3300039437 Bacteria 4689
147 Ga0436365_1874497 3300039437 Bacteria 1980
148 Ga0436361_0065005 3300039447 Bacteria 1378
149 Ga0436361_0075975 3300039447 Bacteria 5616
150 Ga0436361_0426734 3300039447 Bacteria 3777
151 Ga0436361_0668668 3300039447 Bacteria 3423
152 Ga0436361_1119583 3300039447 Bacteria 2659
153 Ga0436361_1178984 3300039447 Bacteria 3360
154 Ga0495603_0041682 3300046455 Bacteria 2745
155 Ga0495606_0033738 3300046507 Bacteria 3525
156 Ga0495606_0084677 3300046507 Bacteria 1963
157 Ga0495654_0063788 3300046530 Bacteria 1763
158 Ga0495659_0002650 3300046664 Bacteria 5762
159 Ga0495659_0081287 3300046664 Bacteria 1230
160 Ga0495649_0016402 3300046694 Bacteria 4197
161 Ga0495589_0092043 3300046794 Bacteria 1472
162 Ga0495683_0078895 3300047323 Bacteria 1608
163 Ga0495683_0143911 3300047323 Bacteria 1115
164 Ga0496102_0443625 3300048905 Bacteria 1218
165 Ga0496102_0700544 3300048905 Bacteria 936
166 Ga0496106_0283603 3300048909 Bacteria 1327
167 Ga0496108_0066732 3300048911 Bacteria 3035
168 Ga0496109_0357136 3300048912 Bacteria 1380
169 Ga0496113_0066098 3300048916 Bacteria 2738
170 Ga0496126_0048635 3300048929 Bacteria 3873
171 Ga0501034_0330125 3300049571 Bacteria 1457
172 Ga0501040_0116811 3300049576 Bacteria 1869
173 Ga0501041_0118909 3300049577 Bacteria 1641
174 Ga0501071_0422692 3300049587 Bacteria 1019
175 Ga0501077_0066099 3300049593 Bacteria 2294
176 Ga0501081_0027476 3300049743 Bacteria 3838
177 nmdc:mga0k408_184310_c1 3300050493 Bacteria 1245
178 nmdc:mga06z11_111240_c1 3300050494 Bacteria 1517
179 nmdc:mga07m45_6509_c1 3300050496 Bacteria 5909
180 nmdc:mga05p37_476009_c1 3300050507 Bacteria 1440
181 nmdc:mga09592_115164_c1 3300050508 Bacteria 2307
182 nmdc:mga09592_50227_c1 3300050508 Bacteria 3518
183 nmdc:mga0qj67_66090_c1 3300050509 Bacteria 2880
184 nmdc:mga06r32_141664_c1 3300050510 Bacteria 2381
185 nmdc:mga06r32_44402_c1 3300050510 Bacteria 4232
186 nmdc:mga0n895_302279_c1 3300050512 Bacteria 1622
187 nmdc:mga0rr50_21438_c1 3300050513 Bacteria 4411
188 nmdc:mga0a205_141780_c1 3300050515 Bacteria 2303
189 Ga0500616_0000056 3300053153 Bacteria 281579
190 Ga0500636_0075964 3300053177 Bacteria 1943
191 Ga0500645_046449 3300053730 Bacteria 1274
192 Ga0530510_0080656 3300061734 Bacteria 2368
193 Ga0070717_10007431
194 Ga0055524_1003389
195 Ga0065712_10069268
196 Ga0070658_10554286
197 Ga0070690_100039548
198 Ga0070670_100097004
199 Ga0068869_100121206
200 Ga0070680_100037237
201 Ga0068868_100191646
202 Ga0070687_100101931
203 Ga0070671_100007199
204 Ga0070671_100563346
205 Ga0070659_100127115
206 Ga0070667_100461136
207 Ga0070667_100486681
208 Ga0070714_100043222
209 Ga0070705_100072006
210 Ga0070700_100101377
211 Ga0070694_100002446
212 Ga0070663_100140145
213 Ga0070678_100635679
214 Ga0070681_10537159
215 Ga0068867_100003365
216 Ga0070706_100008239
217 Ga0070698_100570167
218 Ga0070679_100289589
219 Ga0068853_100224141
220 Ga0068853_100976132
221 Ga0070672_100038772
222 Ga0070672_100401807
223 Ga0070686_100038872
224 Ga0070693_100000154
225 Ga0068855_100131102
226 Ga0070664_100081567
227 Ga0070664_100101308
228 Ga0068854_100619373
229 Ga0068856_100201889
230 Ga0068856_100714400
231 Ga0070702_100001093
232 Ga0070702_100112425
233 Ga0068859_100112842
234 Ga0068859_100140388
235 Ga0068859_100769961
236 Ga0068858_100005494
237 Ga0068858_100082493
238 Ga0068858_100166879
239 Ga0068860_100162951
240 Ga0068862_100079906
241 Ga0068862_100484598
242 Ga0081455_10001215
243 Ga0081455_10021693
244 Ga0081455_10064997
245 Ga0070715_10236475
246 Ga0075367_10024754
247 Ga0075366_10184075
248 Ga0075370_10204554
249 Ga0068871_100201848
250 Ga0075428_100420293
251 Ga0075430_100070902
252 Ga0075433_10177250
253 Ga0075434_100493936
254 Ga0097620_100112842
255 Ga0097620_100140392
256 Ga0097620_100769964
257 Ga0075435_100044537
258 Ga0105240_10007360
259 Ga0105240_10015197
260 Ga0105240_10547617
261 Ga0111539_10016441
262 Ga0114129_10012284
263 Ga0114129_10064873
264 Ga0114129_10067701
265 Ga0114129_10072990
266 Ga0105243_10076277
267 Ga0105237_10005781
268 Ga0105238_10038091
269 Ga0105238_10408111
270 Ga0105249_10008874
271 Ga0105249_10588285
272 Ga0163162_10444252
273 Ga0157375_10179200
274 Ga0163163_10303531
275 Ga0157379_10299524
276 Ga0157379_10419252
277 Ga0157376_10446374
278 Ga0157376_10493246
279 Ga0213872_10036359
280 Ga0213872_10042372
281 Ga0213872_10064304
282 Ga0213876_10074437
283 Ga0213876_10128404
284 Ga0209256_1000064
285 Ga0207684_10005885
286 Ga0207695_10025511
287 Ga0207695_10030677
288 Ga0207671_10113494
289 Ga0207660_10033166
290 Ga0207662_10002400
291 Ga0207646_10005490
292 Ga0207694_10120727
293 Ga0207659_10005940
294 Ga0207700_10068568
295 Ga0207664_10143317
296 Ga0207644_10015081
297 Ga0207690_10095243
298 Ga0207709_10174600
299 Ga0207670_10080332
300 Ga0207691_10005645
301 Ga0207711_10017825
302 Ga0207689_10135402
303 Ga0207679_10124058
304 Ga0207651_10426032
305 Ga0207712_10095456
306 Ga0207712_10491866
307 Ga0207640_10177962
308 Ga0207658_10225853
309 Ga0207658_10273569
310 Ga0207703_10171481
311 Ga0207703_10221151
312 Ga0207639_10217837
313 Ga0207639_10384048
314 Ga0207639_10879190
315 Ga0207678_10200000
316 Ga0207648_10144521
317 Ga0207675_100144202
318 Ga0207683_10341076
319 Ga0207428_10083421
320 Ga0268265_10272973
321 Ga0268265_10330215
322 Ga0268264_10179383
323 Ga0265338_10168632
324 Ga0265338_10212803
325 Ga0307509_10294836
326 Ga0307516_10038496
327 Ga0373923_0009317
328 Ga0373954_0109916
329 Ga0373943_0003012
330 Ga0373946_0003104
331 Ga0373955_0083447
332 Ga0373924_0017683
333 Ga0373927_0016845
334 Ga0373927_0542109
335 Ga0373947_0133033
336 Ga0373937_0521597
337 Ga0373925_0013538
338 Ga0436365_0751647
339 Ga0436365_1874497
340 Ga0436361_0065005
341 Ga0436361_0075975
342 Ga0436361_0426734
343 Ga0436361_0668668
344 Ga0436361_1119583
345 Ga0436361_1178984
346 Ga0495603_0041682
347 Ga0495606_0033738
348 Ga0495606_0084677
349 Ga0495654_0063788
350 Ga0495659_0002650
351 Ga0495659_0081287
352 Ga0495649_0016402
353 Ga0495589_0092043
354 Ga0495683_0078895
355 Ga0495683_0143911
356 Ga0496102_0443625
357 Ga0496102_0700544
358 Ga0496106_0283603
359 Ga0496108_0066732
360 Ga0496109_0357136
361 Ga0496113_0066098
362 Ga0496126_0048635
363 Ga0501034_0330125
364 Ga0501040_0116811
365 Ga0501041_0118909
366 Ga0501071_0422692
367 Ga0501077_0066099
368 Ga0501081_0027476
369 nmdc:mga0k408_184310_c1
370 nmdc:mga06z11_111240_c1
371 nmdc:mga07m45_6509_c1
372 nmdc:mga05p37_476009_c1
373 nmdc:mga09592_115164_c1
374 nmdc:mga09592_50227_c1
375 nmdc:mga0qj67_66090_c1
376 nmdc:mga06r32_141664_c1
377 nmdc:mga06r32_44402_c1
378 nmdc:mga0n895_302279_c1
379 nmdc:mga0rr50_21438_c1
380 nmdc:mga0a205_141780_c1
381 Ga0500616_0000056
382 Ga0500636_0075964
383 Ga0500645_046449
384 Ga0530510_0080656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fl4-assembly1.cif.gz_NV human nuclear pre-60s ribosomal subunit (state i3) 0.8752 20 55
6v9g-assembly2.cif.gz_B kindlin-3 double deletion mutant long form 0.8541 30 56
1mae-assembly1.cif.gz_H the active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor 0.8523 30 54
6i04-assembly1.cif.gz_A crystal structure of sema domain of the met receptor in complex with fab 0.8311 17 55
6u4k-assembly1.cif.gz_A human talin2 residues 1-403 0.8293 30 56
ID Description Score Start End Superfamily
af_I1MVZ2_1_129_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9144 20 55 2.130.10.10
af_A0A1D6LIJ2_883_1045_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.9129 24 55 2.110.10.10
af_E7FDE3_26_285_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9021 19 55 2.130.10.10
af_Q9C037_300_499_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 0.8991 30 57 2.60.120.920
af_A0A0N7KTM1_231_502_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.899 30 55 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1G6B4A0-F1-model_v4 Uncharacterized protein 0.8682 21 58
AF-A0A452ZBA9-F1-model_v4 DUF1618 domain-containing protein 0.8643 29 56
AF-A0A535CN87-F1-model_v4 Glutamine cyclotransferase 0.857 1 59 GO:0016740
AF-A0A3E0BWD9-F1-model_v4 deleted 0.8555 1 70
AF-A0A1B6GT71-F1-model_v4 DH domain-containing protein 0.8485 24 76 GO:0005085
GO:0030036
GO:0051496

Map