F295275

General Info

Members Datasets Scaffolds Average Seq Length
192 133 384 164

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10441441|Ga0070685_104414412
Length 170
Sequence MAPMRITLALAAPFLVVLASSSARAADAGAPAAKVVGPPEVAWKDLTKDQKMKFMKAVINPKMKVTFQKFDPKAFEKFGCATCHGKDAKDREFKMPNPKAEIHPLPDNPKEFQALMAKKPEWPKFAKFMGEEVTPQMAQLLNIPKFDPKKPDPNAFGCKECHTLKKGLTD

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.29
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 26.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10441441 3300005466 Bacteria 910
2 rootH2_10190341 3300003320 Bacteria 1413
3 rootH1_10099726 3300003323 Bacteria 1823
4 rootH1_10159389 3300003323 Bacteria 3415
5 Ga0065712_10380647 3300005290 Unclassified 752
6 Ga0070676_10285947 3300005328 Unclassified 1113
7 Ga0070676_10599796 3300005328 Bacteria 794
8 Ga0070683_100012689 3300005329 Bacteria 7327
9 Ga0070683_100060308 3300005329 Bacteria 3526
10 Ga0070683_100639441 3300005329 Bacteria 1018
11 Ga0070683_100645901 3300005329 Bacteria 1013
12 Ga0070683_100796914 3300005329 Bacteria 906
13 Ga0070690_100060160 3300005330 Bacteria 2444
14 Ga0070670_100028037 3300005331 Bacteria 4846
15 Ga0070670_100366823 3300005331 Unclassified 1267
16 Ga0068869_100191618 3300005334 Unclassified 1608
17 Ga0070666_10128307 3300005335 Bacteria 1761
18 Ga0070682_101070501 3300005337 Bacteria 673
19 Ga0068868_100952859 3300005338 Unclassified 783
20 Ga0068868_101323047 3300005338 Bacteria 670
21 Ga0070660_100377547 3300005339 Bacteria 1170
22 Ga0070689_100046064 3300005340 Bacteria 3360
23 Ga0070689_101265023 3300005340 Unclassified 664
24 Ga0070691_10038395 3300005341 Bacteria 2261
25 Ga0070687_100008896 3300005343 Bacteria 4273
26 Ga0070687_100022795 3300005343 Bacteria 2966
27 Ga0070692_10023173 3300005345 Unclassified 3040
28 Ga0070668_100067497 3300005347 Bacteria 2778
29 Ga0070669_100005079 3300005353 Bacteria 9513
30 Ga0070674_100034050 3300005356 Bacteria 3398
31 Ga0070673_100084420 3300005364 Unclassified 2583
32 Ga0070673_100180055 3300005364 Bacteria 1809
33 Ga0070673_101231526 3300005364 Unclassified 702
34 Ga0070688_100126469 3300005365 Unclassified 1719
35 Ga0070688_100313424 3300005365 Bacteria 1138
36 Ga0070688_100395393 3300005365 Unclassified 1022
37 Ga0070659_100251458 3300005366 Bacteria 1465
38 Ga0070667_100092768 3300005367 Bacteria 2599
39 Ga0070713_100399233 3300005436 Bacteria 1284
40 Ga0070701_10012027 3300005438 Bacteria 3888
41 Ga0070705_100495702 3300005440 Unclassified 926
42 Ga0070678_100168778 3300005456 Bacteria 1780
43 Ga0070662_100464482 3300005457 Bacteria 1052
44 Ga0068867_100378088 3300005459 Bacteria 1189
45 Ga0070685_10068826 3300005466 Unclassified 2092
46 Ga0070706_101011541 3300005467 Bacteria 766
47 Ga0070679_100006771 3300005530 Bacteria 10687
48 Ga0070679_100059718 3300005530 Bacteria 3800
49 Ga0070684_101190928 3300005535 Unclassified 716
50 Ga0070672_100201130 3300005543 Bacteria 1666
51 Ga0070686_100004137 3300005544 Bacteria 7983
52 Ga0070686_100148432 3300005544 Unclassified 1639
53 Ga0070665_100184177 3300005548 Unclassified 2089
54 Ga0068855_100034776 3300005563 Bacteria 6005
55 Ga0068857_100503615 3300005577 Unclassified 1137
56 Ga0068856_100147597 3300005614 Bacteria 2359
57 Ga0070702_100225089 3300005615 Bacteria 1257
58 Ga0068852_100013407 3300005616 Bacteria 6274
59 Ga0068866_10013446 3300005718 Bacteria 3592
60 Ga0068861_100655063 3300005719 Unclassified 970
61 Ga0068863_100206867 3300005841 Unclassified 1889
62 Ga0068858_100387865 3300005842 Bacteria 1341
63 Ga0068858_100905557 3300005842 Unclassified 862
64 Ga0070716_100301623 3300006173 Bacteria 1114
65 Ga0097621_100288181 3300006237 Unclassified 1447
66 Ga0068871_100195970 3300006358 Unclassified 1742
67 Ga0068871_100909509 3300006358 Unclassified 816
68 Ga0075428_101979657 3300006844 Unclassified 604
69 Ga0075429_100350024 3300006880 Unclassified 1293
70 Ga0068865_100005289 3300006881 Bacteria 7809
71 Ga0105240_10404908 3300009093 Bacteria 1536
72 Ga0105240_11934918 3300009093 Unclassified 613
73 Ga0111539_11505994 3300009094 Bacteria 780
74 Ga0105243_10054583 3300009148 Archaea 3173
75 Ga0157374_10090900 3300013296 Bacteria 2910
76 Ga0157374_10979878 3300013296 Unclassified 864
77 Ga0163162_11500006 3300013306 Bacteria 768
78 Ga0157375_10681052 3300013308 Unclassified 1183
79 Ga0157375_10912988 3300013308 Bacteria 1022
80 Ga0157375_11429644 3300013308 Bacteria 815
81 Ga0157380_10702520 3300014326 Bacteria 1016
82 Ga0157377_10758252 3300014745 Unclassified 711
83 Ga0157379_10110610 3300014968 Unclassified 2467
84 Ga0157376_10303324 3300014969 Bacteria 1512
85 Ga0157376_10345768 3300014969 Bacteria 1422
86 Ga0207666_1008592 3300025271 Bacteria 1367
87 Ga0207697_10040644 3300025315 Bacteria 1909
88 Ga0207697_10081166 3300025315 Unclassified 1366
89 Ga0207692_10050743 3300025898 Bacteria 2100
90 Ga0207680_10108555 3300025903 Bacteria 1796
91 Ga0207680_10271473 3300025903 Bacteria 1176
92 Ga0207645_10308384 3300025907 Unclassified 1054
93 Ga0207660_10175013 3300025917 Bacteria 1664
94 Ga0207662_10022819 3300025918 Bacteria 3592
95 Ga0207662_10105462 3300025918 Bacteria 1751
96 Ga0207657_10463880 3300025919 Unclassified 993
97 Ga0207652_10013317 3300025921 Bacteria 6659
98 Ga0207652_10464754 3300025921 Bacteria 1140
99 Ga0207681_10000411 3300025923 Bacteria 29888
100 Ga0207659_10049169 3300025926 Bacteria 2990
101 Ga0207659_10533336 3300025926 Bacteria 996
102 Ga0207690_10768005 3300025932 Unclassified 795
103 Ga0207709_10026132 3300025935 Archaea 3350
104 Ga0207670_10028852 3300025936 Bacteria 3528
105 Ga0207670_10034307 3300025936 Bacteria 3278
106 Ga0207670_10715428 3300025936 Bacteria 830
107 Ga0207669_10114008 3300025937 Unclassified 1818
108 Ga0207704_10002995 3300025938 Bacteria 7642
109 Ga0207704_10056196 3300025938 Bacteria 2410
110 Ga0207691_10016266 3300025940 Archaea 7063
111 Ga0207691_10085667 3300025940 Bacteria 2828
112 Ga0207691_10614932 3300025940 Bacteria 919
113 Ga0207661_10002084 3300025944 Bacteria 13760
114 Ga0207661_10063395 3300025944 Bacteria 2994
115 Ga0207661_10593963 3300025944 Bacteria 1016
116 Ga0207661_11087661 3300025944 Bacteria 736
117 Ga0207667_10326575 3300025949 Bacteria 1567
118 Ga0207667_10865592 3300025949 Unclassified 897
119 Ga0207667_10952289 3300025949 Unclassified 848
120 Ga0207651_10062707 3300025960 Bacteria 2592
121 Ga0207651_10369378 3300025960 Bacteria 1213
122 Ga0207651_10583622 3300025960 Bacteria 975
123 Ga0207651_10770731 3300025960 Unclassified 851
124 Ga0207668_10015100 3300025972 Archaea 4793
125 Ga0207658_10070517 3300025986 Bacteria 2644
126 Ga0207677_11179472 3300026023 Unclassified 700
127 Ga0207703_10593627 3300026035 Bacteria 1047
128 Ga0207678_11154520 3300026067 Unclassified 686
129 Ga0207708_10118184 3300026075 Bacteria 2064
130 Ga0207702_10441359 3300026078 Bacteria 1261
131 Ga0207702_10691680 3300026078 Bacteria 1005
132 Ga0207702_11024975 3300026078 Bacteria 819
133 Ga0207641_10363161 3300026088 Unclassified 1383
134 Ga0207648_10136967 3300026089 Unclassified 2157
135 Ga0207683_10242449 3300026121 Unclassified 1644
136 Ga0207698_10021397 3300026142 Bacteria 4472
137 Ga0207428_10023472 3300027907 Bacteria 5188
138 Ga0268266_10096885 3300028379 Bacteria 2594
139 Ga0265340_10018986 3300031247 Bacteria 3542
140 Ga0373950_0000005 3300034818 Bacteria 404272
141 Ga0373950_0000044 3300034818 Bacteria 104687
142 Ga0373923_0089744 3300035111 Bacteria 1343
143 Ga0373953_0034676 3300035117 Bacteria 1979
144 Ga0373954_0011708 3300035118 Bacteria 3892
145 Ga0373954_0202788 3300035118 Bacteria 975
146 Ga0373956_0011900 3300035119 Bacteria 3596
147 Ga0373956_0148728 3300035119 Bacteria 1102
148 Ga0373957_0022328 3300035120 Bacteria 2254
149 Ga0373957_0332052 3300035120 Bacteria 648
150 Ga0373943_0008382 3300035170 Bacteria 4638
151 Ga0373955_0003275 3300035172 Bacteria 7097
152 Ga0373955_0302130 3300035172 Bacteria 965
153 Ga0373955_0398053 3300035172 Unclassified 836
154 Ga0373955_1008941 3300035172 Bacteria 513
155 Ga0373924_0066760 3300035410 Bacteria 1513
156 Ga0373947_0250851 3300035725 Unclassified 1170
157 Ga0373937_0002239 3300036401 Bacteria 16160
158 Ga0373937_0066279 3300036401 Bacteria 3325
159 Ga0373937_0113450 3300036401 Bacteria 2522
160 Ga0373925_0027151 3300037068 Bacteria 4193
161 Ga0373925_0102849 3300037068 Unclassified 2198
162 Ga0373925_0158075 3300037068 Bacteria 1784
163 Ga0451800_1437743 3300041459 Bacteria 626
164 Ga0495628_0133948 3300046516 Bacteria 1894
165 Ga0495630_0468767 3300046517 Bacteria 965
166 Ga0495586_0011344 3300046535 Bacteria 4739
167 Ga0495634_0001185 3300046642 Bacteria 24146
168 Ga0495657_0231355 3300046675 Bacteria 1118
169 Ga0495674_0005847 3300047319 Bacteria 11798
170 Ga0495680_0116432 3300047322 Bacteria 1976
171 Ga0495684_0790624 3300047471 Unclassified 621
172 Ga0496100_0101185 3300048903 Bacteria 1986
173 Ga0496101_0021963 3300048904 Bacteria 4387
174 Ga0496104_0029865 3300048907 Bacteria 5061
175 Ga0496107_0170124 3300048910 Unclassified 1617
176 Ga0496108_0109492 3300048911 Bacteria 2361
177 Ga0496109_0138301 3300048912 Bacteria 2277
178 Ga0496110_1271133 3300048913 Unclassified 645
179 Ga0496114_0000533 3300048917 Bacteria 28059
180 Ga0496114_0008669 3300048917 Bacteria 8060
181 Ga0496114_0066211 3300048917 Bacteria 3028
182 Ga0496115_0018076 3300048918 Bacteria 5404
183 Ga0496115_0192536 3300048918 Bacteria 1685
184 Ga0496115_0400862 3300048918 Bacteria 1113
185 Ga0501067_0000155 3300049583 Bacteria 37990
186 Ga0501073_0005241 3300049589 Bacteria 9720
187 Ga0501080_0180669 3300049742 Bacteria 1942
188 nmdc:mga09592_382831_c1 3300050508 Unclassified 1216
189 nmdc:mga08y16_12144_c1 3300050511 Bacteria 9053
190 Ga0495601_0299289 3300053077 Unclassified 1048
191 Ga0495595_0074506 3300053084 Bacteria 1609
192 Ga0466962_0527787 3300061719 Bacteria 599
193 Ga0070685_10441441
194 rootH2_10190341
195 rootH1_10099726
196 rootH1_10159389
197 Ga0065712_10380647
198 Ga0070676_10285947
199 Ga0070676_10599796
200 Ga0070683_100012689
201 Ga0070683_100060308
202 Ga0070683_100639441
203 Ga0070683_100645901
204 Ga0070683_100796914
205 Ga0070690_100060160
206 Ga0070670_100028037
207 Ga0070670_100366823
208 Ga0068869_100191618
209 Ga0070666_10128307
210 Ga0070682_101070501
211 Ga0068868_100952859
212 Ga0068868_101323047
213 Ga0070660_100377547
214 Ga0070689_100046064
215 Ga0070689_101265023
216 Ga0070691_10038395
217 Ga0070687_100008896
218 Ga0070687_100022795
219 Ga0070692_10023173
220 Ga0070668_100067497
221 Ga0070669_100005079
222 Ga0070674_100034050
223 Ga0070673_100084420
224 Ga0070673_100180055
225 Ga0070673_101231526
226 Ga0070688_100126469
227 Ga0070688_100313424
228 Ga0070688_100395393
229 Ga0070659_100251458
230 Ga0070667_100092768
231 Ga0070713_100399233
232 Ga0070701_10012027
233 Ga0070705_100495702
234 Ga0070678_100168778
235 Ga0070662_100464482
236 Ga0068867_100378088
237 Ga0070685_10068826
238 Ga0070706_101011541
239 Ga0070679_100006771
240 Ga0070679_100059718
241 Ga0070684_101190928
242 Ga0070672_100201130
243 Ga0070686_100004137
244 Ga0070686_100148432
245 Ga0070665_100184177
246 Ga0068855_100034776
247 Ga0068857_100503615
248 Ga0068856_100147597
249 Ga0070702_100225089
250 Ga0068852_100013407
251 Ga0068866_10013446
252 Ga0068861_100655063
253 Ga0068863_100206867
254 Ga0068858_100387865
255 Ga0068858_100905557
256 Ga0070716_100301623
257 Ga0097621_100288181
258 Ga0068871_100195970
259 Ga0068871_100909509
260 Ga0075428_101979657
261 Ga0075429_100350024
262 Ga0068865_100005289
263 Ga0105240_10404908
264 Ga0105240_11934918
265 Ga0111539_11505994
266 Ga0105243_10054583
267 Ga0157374_10090900
268 Ga0157374_10979878
269 Ga0163162_11500006
270 Ga0157375_10681052
271 Ga0157375_10912988
272 Ga0157375_11429644
273 Ga0157380_10702520
274 Ga0157377_10758252
275 Ga0157379_10110610
276 Ga0157376_10303324
277 Ga0157376_10345768
278 Ga0207666_1008592
279 Ga0207697_10040644
280 Ga0207697_10081166
281 Ga0207692_10050743
282 Ga0207680_10108555
283 Ga0207680_10271473
284 Ga0207645_10308384
285 Ga0207660_10175013
286 Ga0207662_10022819
287 Ga0207662_10105462
288 Ga0207657_10463880
289 Ga0207652_10013317
290 Ga0207652_10464754
291 Ga0207681_10000411
292 Ga0207659_10049169
293 Ga0207659_10533336
294 Ga0207690_10768005
295 Ga0207709_10026132
296 Ga0207670_10028852
297 Ga0207670_10034307
298 Ga0207670_10715428
299 Ga0207669_10114008
300 Ga0207704_10002995
301 Ga0207704_10056196
302 Ga0207691_10016266
303 Ga0207691_10085667
304 Ga0207691_10614932
305 Ga0207661_10002084
306 Ga0207661_10063395
307 Ga0207661_10593963
308 Ga0207661_11087661
309 Ga0207667_10326575
310 Ga0207667_10865592
311 Ga0207667_10952289
312 Ga0207651_10062707
313 Ga0207651_10369378
314 Ga0207651_10583622
315 Ga0207651_10770731
316 Ga0207668_10015100
317 Ga0207658_10070517
318 Ga0207677_11179472
319 Ga0207703_10593627
320 Ga0207678_11154520
321 Ga0207708_10118184
322 Ga0207702_10441359
323 Ga0207702_10691680
324 Ga0207702_11024975
325 Ga0207641_10363161
326 Ga0207648_10136967
327 Ga0207683_10242449
328 Ga0207698_10021397
329 Ga0207428_10023472
330 Ga0268266_10096885
331 Ga0265340_10018986
332 Ga0373950_0000005
333 Ga0373950_0000044
334 Ga0373923_0089744
335 Ga0373953_0034676
336 Ga0373954_0011708
337 Ga0373954_0202788
338 Ga0373956_0011900
339 Ga0373956_0148728
340 Ga0373957_0022328
341 Ga0373957_0332052
342 Ga0373943_0008382
343 Ga0373955_0003275
344 Ga0373955_0302130
345 Ga0373955_0398053
346 Ga0373955_1008941
347 Ga0373924_0066760
348 Ga0373947_0250851
349 Ga0373937_0002239
350 Ga0373937_0066279
351 Ga0373937_0113450
352 Ga0373925_0027151
353 Ga0373925_0102849
354 Ga0373925_0158075
355 Ga0451800_1437743
356 Ga0495628_0133948
357 Ga0495630_0468767
358 Ga0495586_0011344
359 Ga0495634_0001185
360 Ga0495657_0231355
361 Ga0495674_0005847
362 Ga0495680_0116432
363 Ga0495684_0790624
364 Ga0496100_0101185
365 Ga0496101_0021963
366 Ga0496104_0029865
367 Ga0496107_0170124
368 Ga0496108_0109492
369 Ga0496109_0138301
370 Ga0496110_1271133
371 Ga0496114_0000533
372 Ga0496114_0008669
373 Ga0496114_0066211
374 Ga0496115_0018076
375 Ga0496115_0192536
376 Ga0496115_0400862
377 Ga0501067_0000155
378 Ga0501073_0005241
379 Ga0501080_0180669
380 nmdc:mga09592_382831_c1
381 nmdc:mga08y16_12144_c1
382 Ga0495601_0299289
383 Ga0495595_0074506
384 Ga0466962_0527787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rcn-assembly1.cif.gz_A crystal structure of beta-n-acetylhexosaminidase from arthrobacter aurescens 0.4413 120 168
6byg-assembly1.cif.gz_B crystal structure of the nucleophile mutant (e575a) of the gh2 exo-beta-mannanase from xanthomonas axonopodis pv. citri 0.2869 110 167
6teu-assembly1.cif.gz_A crystal structure of full-length human lysyl hydroxylase lh3 - val80lys mutant - cocrystal with fe2+, mn2+ 0.2674 83 153
8one-assembly1.cif.gz_A-2 crystal structure of full-length human lysyl hydroxylase lh3 - asp190ser mutant - cocrystal with fe2+, mn2+, udp-glucose 0.2652 83 154
6fxr-assembly1.cif.gz_A crystal structure of full-length human lysyl hydroxylase lh3 - cocrystal with fe2+, mn2+, udp-gal 0.2649 83 154
ID Description Score Start End Superfamily
af_Q9I7H9_57_285_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7968 117 148 2.60.120.620
af_Q20679_557_729_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6279 123 154 2.60.120.620
3eayA02 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Ubiquitin-related 0.4204 121 167 3.30.310.130
af_A0A1D6F768_103_335_3.40.395.10 Alpha Beta;3-Layer(aba) Sandwich;Adenoviral Proteinase; Chain;Adenoviral Proteinase; Chain A 0.3131 108 167 3.40.395.10
af_Q27481_1018_1112_3.10.290.60 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;Ubiquitin-activating enzyme E1, UFD domain 0.2216 126 169 3.10.290.60
ID Description Score Start End GO Terms
AF-A0A150RKK4-F1-model_v4 Uncharacterized protein 0.9289 46 172
AF-A0A150RKK4-F1-model_v4 Uncharacterized protein 0.9082 46 172
AF-A0A7X7GX70-F1-model_v4 Cytochrome c domain-containing protein 0.8937 51 168
AF-A0A1M5V553-F1-model_v4 Cytochrome c domain-containing protein 0.8891 46 165 GO:0016020
AF-A0A661N8W7-F1-model_v4 Uncharacterized protein 0.8881 51 167

Map