F294755

General Info

Members Datasets Scaffolds Average Seq Length
191 129 382 274

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_88439_c1|nmdc:mga05p37_88439_c1_620_1573
Length 317
Sequence VVPADLVVIEHRAPLGYLLAVGGNYDFTLARRPFSHDVGGGMPALTTEKLGATVGALVEGVDQDRLLTDDGFPTWCLEALEANGALVFRDLHIDDATQVAFSKRLGQVEVFGTGEHPEIFRVTLDPAKNPAAEYLRGTFDWHIDGCTDDIPIMATLLSAHAVAESGGETEFASTYAAYDDLSAAEKDRYGEVRVVHTLEASQRLVNPDPSPEALAIWRRRPPKEHPLVWRHRSGRCSLVLGATTDTVVGLGPDEGRALLDDLLARATAPDRVYRHQWAVGDMVIWDNRGVLHRACPYDSSSPRDMHRTTLAGDEPIQ

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
42 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
43 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
44 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
45 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
46 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
49 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
50 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
51 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
116 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
117 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
126 2547132424 Nocardia nova SH22a Isolate Unclassified
127 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
128 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
129 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0.52
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.52
Nodule 0.52
Rhizoplane 8.38
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_88439_c1 3300050507 Bacteria 3818
2 Ga0070675_100330797 3300005354 Bacteria 1348
3 Ga0070674_100230563 3300005356 Bacteria 1445
4 Ga0070710_10030789 3300005437 Bacteria 2890
5 Ga0070708_100002663 3300005445 Bacteria 13830
6 Ga0070707_100064904 3300005468 Bacteria 3507
7 Ga0070699_100001345 3300005518 Bacteria 22648
8 Ga0070697_100162813 3300005536 Bacteria 1885
9 Ga0070665_100411860 3300005548 Bacteria 1360
10 Ga0068856_100725760 3300005614 Bacteria 1014
11 Ga0070702_100296802 3300005615 Bacteria 1116
12 Ga0081455_10002438 3300005937 Bacteria 22176
13 Ga0081455_10150642 3300005937 Bacteria 1794
14 Ga0081538_10012103 3300005981 Bacteria 6938
15 Ga0081539_10010865 3300005985 Bacteria 7313
16 Ga0081539_10012152 3300005985 Bacteria 6684
17 Ga0075365_10044716 3300006038 Bacteria 2903
18 Ga0075365_10193981 3300006038 Bacteria 1422
19 Ga0075365_10422015 3300006038 Bacteria 942
20 Ga0075363_100126895 3300006048 Bacteria 1429
21 Ga0075364_10025818 3300006051 Bacteria 3742
22 Ga0075364_10115830 3300006051 Bacteria 1791
23 Ga0070716_100096197 3300006173 Bacteria 1804
24 Ga0075362_10067105 3300006177 Bacteria 1632
25 Ga0075369_10043202 3300006186 Bacteria 1933
26 Ga0075428_100000955 3300006844 Bacteria 30623
27 Ga0075428_100002709 3300006844 Bacteria 19288
28 Ga0075428_100544461 3300006844 Bacteria 1241
29 Ga0075428_100588569 3300006844 Bacteria 1189
30 Ga0075430_100002600 3300006846 Bacteria 15070
31 Ga0075430_100042219 3300006846 Bacteria 3857
32 Ga0075430_100045445 3300006846 Bacteria 3710
33 Ga0075430_100051372 3300006846 Bacteria 3474
34 Ga0075430_100075597 3300006846 Bacteria 2824
35 Ga0075431_100000463 3300006847 Bacteria 33500
36 Ga0075431_100024926 3300006847 Bacteria 6132
37 Ga0075431_100483545 3300006847 Bacteria 1231
38 Ga0075429_100000747 3300006880 Bacteria 25547
39 Ga0111539_10024442 3300009094 Bacteria 7412
40 Ga0111539_10029279 3300009094 Bacteria 6709
41 Ga0111539_10653897 3300009094 Bacteria 1224
42 Ga0111539_10835242 3300009094 Bacteria 1072
43 Ga0114129_10000160 3300009147 Bacteria 72462
44 Ga0114129_10028399 3300009147 Bacteria 7927
45 Ga0114129_10134334 3300009147 Bacteria 3396
46 Ga0114129_10212344 3300009147 Bacteria 2615
47 Ga0114129_10235025 3300009147 Bacteria 2467
48 Ga0105243_10039507 3300009148 Bacteria 3679
49 Ga0105243_10072919 3300009148 Bacteria 2780
50 Ga0105249_10160178 3300009553 Bacteria 2174
51 Ga0157375_10912627 3300013308 Bacteria 1022
52 Ga0207643_10275408 3300025908 Bacteria 1042
53 Ga0207646_10003535 3300025922 Bacteria 17576
54 Ga0207677_10058168 3300026023 Bacteria 2660
55 Ga0207676_10322748 3300026095 Bacteria 1418
56 Ga0207683_10052543 3300026121 Bacteria 3571
57 Ga0209813_10019518 3300027866 Bacteria 1885
58 Ga0207428_10057820 3300027907 Bacteria 3078
59 Ga0207428_10097253 3300027907 Bacteria 2279
60 Ga0265762_1004759 3300030760 Bacteria 2430
61 Ga0265327_10082669 3300031251 Bacteria 1582
62 Ga0307516_10361897 3300031730 Bacteria 1115
63 Ga0307415_100476420 3300032126 Bacteria 1086
64 Ga0373931_0102125 3300035691 Bacteria 1614
65 Ga0373933_0307816 3300035724 Bacteria 1026
66 Ga0316584_0184969 3300036712 Bacteria 1542
67 Ga0436360_0443165 3300039438 Bacteria 1194
68 Ga0439465_0011627 3300041413 Bacteria 2762
69 Ga0451837_0887534 3300041494 Bacteria 1799
70 Ga0451853_4001379 3300041512 Bacteria 1486
71 Ga0439448_0024581 3300042005 Bacteria 1885
72 Ga0439463_020254 3300042016 Bacteria 1658
73 Ga0439464_0001440 3300042439 Bacteria 5609
74 Ga0439440_0003345 3300042993 Bacteria 3087
75 Ga0466966_0083093 3300044684 Bacteria 1993
76 Ga0466963_0199300 3300044694 Bacteria 1400
77 Ga0466964_0027811 3300044706 Bacteria 2223
78 Ga0466958_0040128 3300045836 Bacteria 2813
79 Ga0466958_0185247 3300045836 Bacteria 1322
80 Ga0466967_0475897 3300045976 Bacteria 1223
81 Ga0495641_0080222 3300046461 Bacteria 1462
82 Ga0495651_0194200 3300046462 Bacteria 1426
83 Ga0495651_0252972 3300046462 Bacteria 1202
84 Ga0495653_0219655 3300046463 Bacteria 1278
85 Ga0495653_0362835 3300046463 Bacteria 929
86 Ga0495585_0201533 3300046492 Bacteria 1013
87 Ga0495608_0014064 3300046511 Bacteria 5554
88 Ga0495628_0281576 3300046516 Unclassified 1235
89 Ga0495628_0389960 3300046516 Bacteria 1019
90 Ga0495630_0033703 3300046517 Bacteria 3820
91 Ga0495630_0033784 3300046517 Bacteria 3815
92 Ga0495587_0006043 3300046536 Bacteria 7894
93 Ga0495634_0231442 3300046642 Bacteria 1137
94 Ga0495625_0122551 3300046660 Unclassified 1768
95 Ga0495657_0053846 3300046675 Bacteria 2691
96 Ga0495623_0028661 3300046679 Bacteria 3582
97 Ga0495658_0034105 3300046683 Bacteria 2791
98 Ga0495658_0277123 3300046683 Bacteria 1058
99 Ga0495613_0000311 3300046689 Bacteria 44152
100 Ga0495613_0000365 3300046689 Bacteria 39454
101 Ga0495670_0205307 3300046691 Bacteria 1044
102 Ga0495600_0028551 3300046809 Bacteria 3610
103 Ga0495600_0088527 3300046809 Bacteria 2020
104 Ga0495604_0183574 3300047317 Bacteria 1462
105 Ga0495680_0005985 3300047322 Bacteria 11373
106 Ga0495680_0095192 3300047322 Bacteria 2227
107 Ga0495680_0120128 3300047322 Bacteria 1941
108 Ga0496100_0006339 3300048903 Bacteria 6446
109 Ga0496101_0010112 3300048904 Bacteria 6222
110 Ga0496102_0257376 3300048905 Unclassified 1646
111 Ga0496103_0282868 3300048906 Bacteria 1067
112 Ga0496104_0264112 3300048907 Unclassified 1634
113 Ga0496106_0072505 3300048909 Bacteria 2634
114 Ga0496107_0071370 3300048910 Bacteria 2523
115 Ga0496108_0261308 3300048911 Bacteria 1507
116 Ga0496110_0011059 3300048913 Bacteria 7368
117 Ga0496110_0499406 3300048913 Bacteria 1108
118 Ga0496112_0256574 3300048915 Bacteria 1699
119 Ga0496114_0039703 3300048917 Bacteria 3895
120 Ga0496114_0407358 3300048917 Unclassified 1204
121 Ga0496114_0507300 3300048917 Bacteria 1067
122 Ga0496115_0001291 3300048918 Bacteria 17897
123 Ga0496115_0022574 3300048918 Bacteria 4878
124 Ga0501033_0002939 3300049570 Bacteria 14246
125 Ga0501040_0292589 3300049576 Bacteria 1164
126 Ga0501042_0159057 3300049578 Bacteria 1630
127 Ga0501046_0081313 3300049580 Bacteria 2502
128 Ga0501046_0100561 3300049580 Bacteria 2219
129 Ga0501047_0201552 3300049581 Bacteria 1851
130 Ga0501047_0239265 3300049581 Bacteria 1666
131 Ga0501067_0017153 3300049583 Bacteria 4002
132 Ga0501068_0010000 3300049584 Bacteria 5319
133 Ga0501068_0064011 3300049584 Bacteria 2237
134 Ga0501069_0012342 3300049585 Bacteria 4540
135 Ga0501070_0101765 3300049586 Bacteria 2376
136 Ga0501070_0306387 3300049586 Bacteria 1293
137 Ga0501071_0057422 3300049587 Bacteria 2813
138 Ga0501071_0310971 3300049587 Bacteria 1195
139 Ga0501072_0006663 3300049588 Bacteria 8784
140 Ga0501073_0000574 3300049589 Bacteria 25952
141 Ga0501073_0002770 3300049589 Bacteria 13128
142 Ga0501074_0001323 3300049590 Bacteria 16448
143 Ga0501074_0334778 3300049590 Bacteria 1074
144 Ga0501076_0226335 3300049592 Bacteria 1529
145 Ga0501076_0495299 3300049592 Bacteria 1007
146 Ga0501079_0004950 3300049741 Bacteria 9877
147 Ga0501080_0019062 3300049742 Bacteria 6351
148 Ga0501080_0314964 3300049742 Bacteria 1417
149 Ga0501083_0001980 3300049744 Bacteria 14085
150 Ga0501083_0076028 3300049744 Bacteria 2229
151 Ga0501044_0001372 3300049823 Bacteria 28555
152 Ga0501044_0007545 3300049823 Bacteria 11959
153 Ga0501044_0090972 3300049823 Bacteria 3078
154 Ga0501044_0206834 3300049823 Bacteria 1919
155 nmdc:mga03683_28546_c1 3300050489 Bacteria 2219
156 nmdc:mga03683_69321_c1 3300050489 Bacteria 1504
157 nmdc:mga03n38_84604_c1 3300050490 Bacteria 1498
158 nmdc:mga00v17_1666_c1 3300050491 Bacteria 11568
159 nmdc:mga0yw44_132913_c1 3300050492 Bacteria 1612
160 nmdc:mga0yw44_1973_c1 3300050492 Bacteria 8506
161 nmdc:mga0yw44_63327_c1 3300050492 Bacteria 2273
162 nmdc:mga07m45_100121_c1 3300050496 Bacteria 1664
163 nmdc:mga05p37_3605_c1 3300050507 Bacteria 18090
164 nmdc:mga05p37_455575_c1 3300050507 Bacteria 1479
165 nmdc:mga05p37_54808_c1 3300050507 Bacteria 4905
166 nmdc:mga09592_1137_c1 3300050508 Bacteria 21197
167 nmdc:mga09592_13289_c1 3300050508 Bacteria 6723
168 nmdc:mga0qj67_102943_c1 3300050509 Bacteria 2303
169 nmdc:mga0qj67_285866_c1 3300050509 Bacteria 1337
170 nmdc:mga06r32_15022_c1 3300050510 Bacteria 7029
171 nmdc:mga06r32_708790_c1 3300050510 Bacteria 972
172 nmdc:mga06r32_98677_c1 3300050510 Bacteria 2864
173 nmdc:mga08y16_109520_c1 3300050511 Bacteria 2876
174 nmdc:mga08y16_48721_c1 3300050511 Bacteria 4434
175 nmdc:mga0n895_585264_c1 3300050512 Bacteria 1119
176 nmdc:mga0sz30_11980_c1 3300050516 Bacteria 3365
177 Ga0495612_0105689 3300053078 Bacteria 1202
178 Ga0500635_0001161 3300053080 Bacteria 6317
179 Ga0495595_0003352 3300053084 Bacteria 6357
180 Ga0495619_0067505 3300053085 Bacteria 2388
181 Ga0500556_0015986 3300053104 Bacteria 2327
182 Ga0500652_000654 3300053131 Bacteria 11787
183 Ga0500622_0000119 3300053156 Bacteria 82219
184 Ga0501084_0003600 3300054114 Bacteria 12584
185 Ga0501082_0122030 3300060353 Bacteria 2259
186 2523382937 2523231044 Bacteria 6434991
187 2548696470 2547132424 Bacteria 8348532
188 2738890768 2738541308 Bacteria 7020677
189 2738892756 2738541308 Bacteria 7020677
190 2744957728 2744054611 Bacteria 5611514
191 8002785772 8002784119 Bacteria 9788632
192 nmdc:mga05p37_88439_c1
193 Ga0070675_100330797
194 Ga0070674_100230563
195 Ga0070710_10030789
196 Ga0070708_100002663
197 Ga0070707_100064904
198 Ga0070699_100001345
199 Ga0070697_100162813
200 Ga0070665_100411860
201 Ga0068856_100725760
202 Ga0070702_100296802
203 Ga0081455_10002438
204 Ga0081455_10150642
205 Ga0081538_10012103
206 Ga0081539_10010865
207 Ga0081539_10012152
208 Ga0075365_10044716
209 Ga0075365_10193981
210 Ga0075365_10422015
211 Ga0075363_100126895
212 Ga0075364_10025818
213 Ga0075364_10115830
214 Ga0070716_100096197
215 Ga0075362_10067105
216 Ga0075369_10043202
217 Ga0075428_100000955
218 Ga0075428_100002709
219 Ga0075428_100544461
220 Ga0075428_100588569
221 Ga0075430_100002600
222 Ga0075430_100042219
223 Ga0075430_100045445
224 Ga0075430_100051372
225 Ga0075430_100075597
226 Ga0075431_100000463
227 Ga0075431_100024926
228 Ga0075431_100483545
229 Ga0075429_100000747
230 Ga0111539_10024442
231 Ga0111539_10029279
232 Ga0111539_10653897
233 Ga0111539_10835242
234 Ga0114129_10000160
235 Ga0114129_10028399
236 Ga0114129_10134334
237 Ga0114129_10212344
238 Ga0114129_10235025
239 Ga0105243_10039507
240 Ga0105243_10072919
241 Ga0105249_10160178
242 Ga0157375_10912627
243 Ga0207643_10275408
244 Ga0207646_10003535
245 Ga0207677_10058168
246 Ga0207676_10322748
247 Ga0207683_10052543
248 Ga0209813_10019518
249 Ga0207428_10057820
250 Ga0207428_10097253
251 Ga0265762_1004759
252 Ga0265327_10082669
253 Ga0307516_10361897
254 Ga0307415_100476420
255 Ga0373931_0102125
256 Ga0373933_0307816
257 Ga0316584_0184969
258 Ga0436360_0443165
259 Ga0439465_0011627
260 Ga0451837_0887534
261 Ga0451853_4001379
262 Ga0439448_0024581
263 Ga0439463_020254
264 Ga0439464_0001440
265 Ga0439440_0003345
266 Ga0466966_0083093
267 Ga0466963_0199300
268 Ga0466964_0027811
269 Ga0466958_0040128
270 Ga0466958_0185247
271 Ga0466967_0475897
272 Ga0495641_0080222
273 Ga0495651_0194200
274 Ga0495651_0252972
275 Ga0495653_0219655
276 Ga0495653_0362835
277 Ga0495585_0201533
278 Ga0495608_0014064
279 Ga0495628_0281576
280 Ga0495628_0389960
281 Ga0495630_0033703
282 Ga0495630_0033784
283 Ga0495587_0006043
284 Ga0495634_0231442
285 Ga0495625_0122551
286 Ga0495657_0053846
287 Ga0495623_0028661
288 Ga0495658_0034105
289 Ga0495658_0277123
290 Ga0495613_0000311
291 Ga0495613_0000365
292 Ga0495670_0205307
293 Ga0495600_0028551
294 Ga0495600_0088527
295 Ga0495604_0183574
296 Ga0495680_0005985
297 Ga0495680_0095192
298 Ga0495680_0120128
299 Ga0496100_0006339
300 Ga0496101_0010112
301 Ga0496102_0257376
302 Ga0496103_0282868
303 Ga0496104_0264112
304 Ga0496106_0072505
305 Ga0496107_0071370
306 Ga0496108_0261308
307 Ga0496110_0011059
308 Ga0496110_0499406
309 Ga0496112_0256574
310 Ga0496114_0039703
311 Ga0496114_0407358
312 Ga0496114_0507300
313 Ga0496115_0001291
314 Ga0496115_0022574
315 Ga0501033_0002939
316 Ga0501040_0292589
317 Ga0501042_0159057
318 Ga0501046_0081313
319 Ga0501046_0100561
320 Ga0501047_0201552
321 Ga0501047_0239265
322 Ga0501067_0017153
323 Ga0501068_0010000
324 Ga0501068_0064011
325 Ga0501069_0012342
326 Ga0501070_0101765
327 Ga0501070_0306387
328 Ga0501071_0057422
329 Ga0501071_0310971
330 Ga0501072_0006663
331 Ga0501073_0000574
332 Ga0501073_0002770
333 Ga0501074_0001323
334 Ga0501074_0334778
335 Ga0501076_0226335
336 Ga0501076_0495299
337 Ga0501079_0004950
338 Ga0501080_0019062
339 Ga0501080_0314964
340 Ga0501083_0001980
341 Ga0501083_0076028
342 Ga0501044_0001372
343 Ga0501044_0007545
344 Ga0501044_0090972
345 Ga0501044_0206834
346 nmdc:mga03683_28546_c1
347 nmdc:mga03683_69321_c1
348 nmdc:mga03n38_84604_c1
349 nmdc:mga00v17_1666_c1
350 nmdc:mga0yw44_132913_c1
351 nmdc:mga0yw44_1973_c1
352 nmdc:mga0yw44_63327_c1
353 nmdc:mga07m45_100121_c1
354 nmdc:mga05p37_3605_c1
355 nmdc:mga05p37_455575_c1
356 nmdc:mga05p37_54808_c1
357 nmdc:mga09592_1137_c1
358 nmdc:mga09592_13289_c1
359 nmdc:mga0qj67_102943_c1
360 nmdc:mga0qj67_285866_c1
361 nmdc:mga06r32_15022_c1
362 nmdc:mga06r32_708790_c1
363 nmdc:mga06r32_98677_c1
364 nmdc:mga08y16_109520_c1
365 nmdc:mga08y16_48721_c1
366 nmdc:mga0n895_585264_c1
367 nmdc:mga0sz30_11980_c1
368 Ga0495612_0105689
369 Ga0500635_0001161
370 Ga0495595_0003352
371 Ga0495619_0067505
372 Ga0500556_0015986
373 Ga0500652_000654
374 Ga0500622_0000119
375 Ga0501084_0003600
376 Ga0501082_0122030
377 2523382937
378 2548696470
379 2738890768
380 2738892756
381 2744957728
382 8002785772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

46

309

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oii-assembly3.cif.gz_C crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with iron and alphaketoglutarate 0.946 5 280
4ffa-assembly1.cif.gz_D sulfatase from mycobacterium tuberculosis 0.9459 5 277
4cvy-assembly2.cif.gz_D crystal structure of the m. tuberculosis sulfate ester dioxygenase rv3406 in complex with iron. 0.9459 5 277
1oij-assembly3.cif.gz_C crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.944 3 277
8evn-assembly1.cif.gz_C sulfatase from mycobacterium tuberculosis (rv3406) in complex with n-oxalylglycine (nog) 0.9428 5 277
ID Description Score Start End Superfamily
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9177 3 280 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8826 4 274 3.60.130.10
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8802 3 280 3.60.130.10
5vn6B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8692 5 277 3.60.130.10
5vn6B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8662 5 277 3.60.130.10
ID Description Score Start End GO Terms
AF-E3IU80-F1-model_v4 Taurine catabolism dioxygenase TauD/TfdA 0.9813 3 278 GO:0046872
GO:0051213
AF-E3IU80-F1-model_v4 Taurine catabolism dioxygenase TauD/TfdA 0.9743 3 278 GO:0046872
GO:0051213
AF-A0A7X9ZQG9-F1-model_v4 TauD/TfdA family dioxygenase 0.9733 3 278 GO:0046872
GO:0051213
AF-A0A1S1R9D6-F1-model_v4 deleted 0.9668 3 278
AF-A0A519ED79-F1-model_v4 deleted 0.9658 100 278

Map