F294537

General Info

Members Datasets Scaffolds Average Seq Length
191 137 189 158

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0831999|Ga0495630_0831999_132_674
Length 180
Sequence MARKYFVRTGAVLICGLSVLAGAFAQMPNPYGAPISLEDAKKVAGPALAEAAKNKWNMAVAVVDGSGNLVYYEKMDATQIGSATVAIDKARSAALFKRPTKTFQDALAAGGDGLRILKLQGAMPVEGGLPVLIEGKIAGAIGVSGGTAAQDGQCAKAGADVVAPKWEFRLKRDVRAKSCV

Samples

Sample ID Description Type Environment
1 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
2 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 1.57
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 5.76
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100434005 3300005331 Bacteria 1162
2 Ga0070670_101250092 3300005331 Bacteria 679
3 Ga0068869_100124965 3300005334 Bacteria 1972
4 Ga0070682_100028752 3300005337 Bacteria 3345
5 Ga0070682_100726740 3300005337 Bacteria 799
6 Ga0068868_100086517 3300005338 Bacteria 2519
7 Ga0068868_100854982 3300005338 Unclassified 824
8 Ga0068868_101288906 3300005338 Unclassified 678
9 Ga0070689_100158147 3300005340 Bacteria 1830
10 Ga0070689_100169476 3300005340 Bacteria 1768
11 Ga0070661_100637207 3300005344 Bacteria 864
12 Ga0070669_100092059 3300005353 Bacteria 2275
13 Ga0070675_100144327 3300005354 Bacteria 2037
14 Ga0070673_100010323 3300005364 Bacteria 6317
15 Ga0070673_100095196 3300005364 Bacteria 2442
16 Ga0070673_100327656 3300005364 Bacteria 1354
17 Ga0070667_101078909 3300005367 Unclassified 750
18 Ga0070714_100426634 3300005435 Unclassified 1257
19 Ga0070710_10162708 3300005437 Bacteria 1385
20 Ga0070710_10476514 3300005437 Unclassified 850
21 Ga0070711_100001604 3300005439 Bacteria 12473
22 Ga0070705_101537545 3300005440 Unclassified 558
23 Ga0070700_100290440 3300005441 Bacteria 1189
24 Ga0070694_101389375 3300005444 Unclassified 592
25 Ga0068867_100125648 3300005459 Bacteria 1988
26 Ga0070685_11187333 3300005466 Bacteria 579
27 Ga0070706_100058013 3300005467 Unclassified 3573
28 Ga0070706_100222473 3300005467 Bacteria 1762
29 Ga0070698_100017941 3300005471 Bacteria 7453
30 Ga0070698_102132821 3300005471 Bacteria 514
31 Ga0070699_100157249 3300005518 Bacteria 2011
32 Ga0070699_100549835 3300005518 Unclassified 1051
33 Ga0070697_100026919 3300005536 Unclassified 4598
34 Ga0070697_100983178 3300005536 Unclassified 750
35 Ga0070672_101034222 3300005543 Bacteria 729
36 Ga0070695_100651266 3300005545 Bacteria 832
37 Ga0070693_101174506 3300005547 Unclassified 588
38 Ga0070665_100017030 3300005548 Bacteria 7288
39 Ga0070704_100265765 3300005549 Unclassified 1415
40 Ga0070664_100044258 3300005564 Bacteria 3759
41 Ga0070664_100403783 3300005564 Bacteria 1250
42 Ga0068854_101126324 3300005578 Unclassified 700
43 Ga0068859_100027669 3300005617 Bacteria 5688
44 Ga0068859_100984353 3300005617 Bacteria 926
45 Ga0068859_101314978 3300005617 Bacteria 797
46 Ga0068866_10067224 3300005718 Bacteria 1881
47 Ga0068861_100477283 3300005719 Unclassified 1123
48 Ga0068861_100513102 3300005719 Bacteria 1086
49 Ga0068863_100206040 3300005841 Bacteria 1893
50 Ga0068858_100012252 3300005842 Bacteria 8084
51 Ga0068858_100052480 3300005842 Bacteria 3773
52 Ga0068858_101042943 3300005842 Unclassified 802
53 Ga0068860_100479440 3300005843 Bacteria 1240
54 Ga0068862_100131046 3300005844 Bacteria 2218
55 Ga0075432_10006180 3300006058 Bacteria 4074
56 Ga0070712_100094511 3300006175 Bacteria 2197
57 Ga0097621_100040193 3300006237 Bacteria 3759
58 Ga0097621_100741182 3300006237 Bacteria 907
59 Ga0075370_10009616 3300006353 Bacteria 5029
60 Ga0068871_100049134 3300006358 Bacteria 3408
61 Ga0068871_100407359 3300006358 Bacteria 1212
62 Ga0075428_101210938 3300006844 Bacteria 796
63 Ga0075434_100312877 3300006871 Bacteria 1591
64 Ga0075434_100542627 3300006871 Archaea 1183
65 Ga0075434_101002305 3300006871 Bacteria 849
66 Ga0068865_100045895 3300006881 Bacteria 2996
67 Ga0068865_100293026 3300006881 Bacteria 1300
68 Ga0068865_100838090 3300006881 Bacteria 796
69 Ga0097620_100027669 3300006931 Bacteria 5688
70 Ga0097620_100984417 3300006931 Bacteria 926
71 Ga0097620_101315141 3300006931 Bacteria 797
72 Ga0099794_10076157 3300007265 Unclassified 1649
73 Ga0105245_10073500 3300009098 Bacteria 3109
74 Ga0105245_10141571 3300009098 Bacteria 2266
75 Ga0105243_11231844 3300009148 Unclassified 763
76 Ga0105241_11805690 3300009174 Bacteria 597
77 Ga0105242_10015208 3300009176 Bacteria 5976
78 Ga0105242_10052642 3300009176 Bacteria 3322
79 Ga0105248_10077620 3300009177 Bacteria 3734
80 Ga0105248_10141030 3300009177 Unclassified 2719
81 Ga0105248_10427347 3300009177 Bacteria 1492
82 Ga0105248_11162632 3300009177 Bacteria 872
83 Ga0105238_10518274 3300009551 Unclassified 1195
84 Ga0105249_11418269 3300009553 Bacteria 766
85 Ga0105249_11632389 3300009553 Bacteria 717
86 Ga0157378_10100619 3300013297 Bacteria 2639
87 Ga0157378_11116851 3300013297 Unclassified 826
88 Ga0157375_10563576 3300013308 Bacteria 1300
89 Ga0163163_10286989 3300014325 Unclassified 1698
90 Ga0163163_11321920 3300014325 Unclassified 783
91 Ga0157380_10202293 3300014326 Unclassified 1763
92 Ga0157379_10291703 3300014968 Unclassified 1486
93 Ga0213876_10361559 3300021384 Unclassified 772
94 Ga0207697_10522601 3300025315 Bacteria 523
95 Ga0207642_10060424 3300025899 Bacteria 1758
96 Ga0207642_10144594 3300025899 Bacteria 1258
97 Ga0207688_10372259 3300025901 Unclassified 883
98 Ga0207680_10175723 3300025903 Bacteria 1445
99 Ga0207684_10049013 3300025910 Unclassified 3583
100 Ga0207663_10006909 3300025916 Bacteria 5847
101 Ga0207662_10181492 3300025918 Bacteria 1354
102 Ga0207646_10397464 3300025922 Unclassified 1245
103 Ga0207681_10674397 3300025923 Bacteria 858
104 Ga0207650_10273589 3300025925 Bacteria 1373
105 Ga0207650_10703354 3300025925 Unclassified 854
106 Ga0207659_10036028 3300025926 Bacteria 3424
107 Ga0207687_10093538 3300025927 Bacteria 2198
108 Ga0207700_10708475 3300025928 Bacteria 899
109 Ga0207664_11083587 3300025929 Unclassified 716
110 Ga0207686_10121080 3300025934 Bacteria 1781
111 Ga0207670_10766866 3300025936 Bacteria 802
112 Ga0207704_10051372 3300025938 Bacteria 2493
113 Ga0207691_10655817 3300025940 Bacteria 886
114 Ga0207711_10219627 3300025941 Bacteria 1738
115 Ga0207711_10646313 3300025941 Bacteria 987
116 Ga0207689_10245951 3300025942 Bacteria 1479
117 Ga0207679_10078573 3300025945 Bacteria 2514
118 Ga0207679_10328473 3300025945 Bacteria 1326
119 Ga0207651_10090190 3300025960 Bacteria 2240
120 Ga0207651_10247637 3300025960 Bacteria 1456
121 Ga0207651_10289333 3300025960 Bacteria 1358
122 Ga0207658_11082872 3300025986 Unclassified 732
123 Ga0207658_11436957 3300025986 Unclassified 631
124 Ga0207677_10072518 3300026023 Bacteria 2434
125 Ga0207677_10983460 3300026023 Unclassified 764
126 Ga0207703_10066720 3300026035 Bacteria 2960
127 Ga0207703_10171856 3300026035 Bacteria 1907
128 Ga0207703_10318369 3300026035 Bacteria 1424
129 Ga0207703_10544559 3300026035 Bacteria 1094
130 Ga0207708_10137941 3300026075 Bacteria 1911
131 Ga0207641_10033760 3300026088 Bacteria 4252
132 Ga0207648_10078934 3300026089 Bacteria 2872
133 Ga0207648_10602810 3300026089 Bacteria 1012
134 Ga0207675_100475283 3300026118 Bacteria 1241
135 Ga0207675_100534648 3300026118 Unclassified 1170
136 Ga0207683_10154315 3300026121 Bacteria 2073
137 Ga0209588_1005977 3300027671 Bacteria 3511
138 Ga0268266_10025989 3300028379 Bacteria 4980
139 Ga0268265_10191937 3300028380 Unclassified 1765
140 Ga0265760_10001376 3300031090 Bacteria 7135
141 Ga0265760_10006173 3300031090 Bacteria 3426
142 Ga0265760_10180963 3300031090 Unclassified 704
143 Ga0265320_10234727 3300031240 Bacteria 815
144 Ga0373953_0259786 3300035117 Bacteria 755
145 Ga0373943_0495238 3300035170 Bacteria 714
146 Ga0373924_0136248 3300035410 Unclassified 1070
147 Ga0373947_0511624 3300035725 Bacteria 816
148 Ga0373937_0226078 3300036401 Bacteria 1762
149 Ga0237819_00832 3300038705 Bacteria 9739
150 Ga0436365_0205220 3300039437 Bacteria 947
151 Ga0436362_0835011 3300039453 Bacteria 884
152 Ga0439439_0054572 3300041406 Unclassified 1053
153 Ga0453684_0491748 3300044712 Bacteria 1360
154 Ga0451576_0753318 3300045051 Bacteria 1023
155 Ga0495592_0578473 3300046454 Bacteria 687
156 Ga0495580_0229840 3300046472 Unclassified 1274
157 Ga0495582_0247825 3300046473 Unclassified 1021
158 Ga0495639_0111277 3300046475 Unclassified 1300
159 Ga0495594_0562755 3300046499 Bacteria 647
160 Ga0495616_0000205 3300046513 Bacteria 49007
161 Ga0495628_0023591 3300046516 Bacteria 5048
162 Ga0495630_0831999 3300046517 Bacteria 704
163 Ga0495665_0225238 3300046531 Unclassified 969
164 Ga0495640_0645856 3300046533 Bacteria 637
165 Ga0495645_0002784 3300046543 Bacteria 11860
166 Ga0495668_0000060 3300046616 Bacteria 193823
167 Ga0495634_0185418 3300046642 Unclassified 1301
168 Ga0495646_0167376 3300046680 Bacteria 1213
169 Ga0495658_0046650 3300046683 Bacteria 2437
170 Ga0495636_0145704 3300047318 Bacteria 1060
171 Ga0495674_0178779 3300047319 Bacteria 1768
172 Ga0496102_0001051 3300048905 Bacteria 25540
173 Ga0496102_1067967 3300048905 Bacteria 727
174 Ga0496103_0008208 3300048906 Bacteria 6198
175 Ga0496104_0252236 3300048907 Bacteria 1677
176 Ga0496105_0091920 3300048908 Unclassified 2506
177 Ga0496105_0636567 3300048908 Bacteria 824
178 Ga0496108_0846428 3300048911 Bacteria 787
179 Ga0496109_1764278 3300048912 Bacteria 552
180 Ga0496114_0428484 3300048917 Unclassified 1172
181 Ga0496114_0533662 3300048917 Bacteria 1037
182 Ga0496115_0127118 3300048918 Bacteria 2100
183 Ga0501034_0165569 3300049571 Bacteria 2180
184 nmdc:mga0n895_399572_c1 3300050512 Archaea 1390
185 nmdc:mga0n895_567373_c1 3300050512 Bacteria 1140
186 nmdc:mga0n895_895766_c1 3300050512 Bacteria 873
187 Ga0495612_0132646 3300053078 Bacteria 1077
188 Ga0495619_0176445 3300053085 Bacteria 1478
189 Ga0501082_0899837 3300060353 Bacteria 774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0491748 Ga0453684_0491748_638_1186 114
2 3300006844 Ga0075428_101210938 Ga0075428_1012109382 119
3 3300025925 Ga0207650_10703354 Ga0207650_107033542 122
4 3300006353 Ga0075370_10009616 Ga0075370_100096161 125
5 3300006871 Ga0075434_100312877 Ga0075434_1003128772 125
6 3300005617 Ga0068859_100984353 Ga0068859_1009843531 126
7 3300006931 Ga0097620_100984417 Ga0097620_1009844172 126
8 3300009553 Ga0105249_11418269 Ga0105249_114182691 126
9 3300026089 Ga0207648_10602810 Ga0207648_106028101 126
10 3300041406 Ga0439439_0054572 Ga0439439_0054572_320_748 126
11 3300045051 Ga0451576_0753318 Ga0451576_0753318_432_866 128
12 3300046513 Ga0495616_0000205 Ga0495616_0000205_43922_44446 129
13 3300014325 Ga0163163_10286989 Ga0163163_102869893 131
14 3300014968 Ga0157379_10291703 Ga0157379_102917031 131
15 3300026035 Ga0207703_10171856 Ga0207703_101718562 131
16 3300009098 Ga0105245_10073500 Ga0105245_100735004 134
17 3300009177 Ga0105248_10141030 Ga0105248_101410304 134
18 3300009553 Ga0105249_11632389 Ga0105249_116323892 134
19 3300005536 Ga0070697_100026919 Ga0070697_1000269195 136
20 3300006237 Ga0097621_100741182 Ga0097621_1007411822 136
21 3300025922 Ga0207646_10397464 Ga0207646_103974642 136
22 3300048905 Ga0496102_1067967 Ga0496102_1067967_43_552 136
23 3300048918 Ga0496115_0127118 Ga0496115_0127118_282_782 136
24 3300050512 nmdc:mga0n895_567373_c1 nmdc:mga0n895_567373_c1_494_1003 136
25 iso_pu_bacteria 2884960567 2884965166 136
26 iso_pu_bacteria 2928531327 2928534353 136
27 3300021384 Ga0213876_10361559 Ga0213876_103615592 137
28 3300039437 Ga0436365_0205220 Ga0436365_0205220_261_752 137
29 3300046616 Ga0495668_0000060 Ga0495668_0000060_48387_48908 137
30 3300048917 Ga0496114_0428484 Ga0496114_0428484_69_560 137
31 3300005331 Ga0070670_101250092 Ga0070670_1012500921 138
32 3300005340 Ga0070689_100158147 Ga0070689_1001581472 138
33 3300005364 Ga0070673_100327656 Ga0070673_1003276562 138
34 3300014325 Ga0163163_11321920 Ga0163163_113219202 138
35 3300025936 Ga0207670_10766866 Ga0207670_107668661 138
36 3300025960 Ga0207651_10289333 Ga0207651_102893331 138
37 3300048912 Ga0496109_1764278 Ga0496109_1764278_16_477 138
38 3300005337 Ga0070682_100028752 Ga0070682_1000287523 140
39 3300031090 Ga0265760_10180963 Ga0265760_101809631 140
40 3300047318 Ga0495636_0145704 Ga0495636_0145704_44_532 140
41 3300048905 Ga0496102_0001051 Ga0496102_0001051_8519_9004 140
42 3300048906 Ga0496103_0008208 Ga0496103_0008208_4224_4709 140
43 3300049571 Ga0501034_0165569 Ga0501034_0165569_344_844 140
44 3300060353 Ga0501082_0899837 Ga0501082_0899837_254_754 140
45 3300005467 Ga0070706_100222473 Ga0070706_1002224731 141
46 3300005471 Ga0070698_102132821 Ga0070698_1021328211 141
47 3300005518 Ga0070699_100157249 Ga0070699_1001572492 141
48 3300005536 Ga0070697_100983178 Ga0070697_1009831781 141
49 3300005564 Ga0070664_100403783 Ga0070664_1004037832 141
50 3300005719 Ga0068861_100513102 Ga0068861_1005131022 141
51 3300005842 Ga0068858_100012252 Ga0068858_1000122527 141
52 3300005844 Ga0068862_100131046 Ga0068862_1001310461 141
53 3300014326 Ga0157380_10202293 Ga0157380_102022932 141
54 3300025899 Ga0207642_10144594 Ga0207642_101445941 141
55 3300025945 Ga0207679_10328473 Ga0207679_103284732 141
56 3300025986 Ga0207658_11082872 Ga0207658_110828721 141
57 3300026035 Ga0207703_10066720 Ga0207703_100667202 141
58 3300026118 Ga0207675_100475283 Ga0207675_1004752832 141
59 3300038705 Ga0237819_00832 Ga0237819_00832_5433_5927 141
60 3300039453 Ga0436362_0835011 Ga0436362_0835011_272_754 141
61 3300005334 Ga0068869_100124965 Ga0068869_1001249652 142
62 3300005337 Ga0070682_100726740 Ga0070682_1007267401 142
63 3300005338 Ga0068868_100086517 Ga0068868_1000865173 142
64 3300005338 Ga0068868_100854982 Ga0068868_1008549822 142
65 3300005338 Ga0068868_101288906 Ga0068868_1012889061 142
66 3300005364 Ga0070673_100010323 Ga0070673_1000103233 142
67 3300005364 Ga0070673_100095196 Ga0070673_1000951962 142
68 3300005440 Ga0070705_101537545 Ga0070705_1015375451 142
69 3300005444 Ga0070694_101389375 Ga0070694_1013893751 142
70 3300005459 Ga0068867_100125648 Ga0068867_1001256482 142
71 3300005518 Ga0070699_100549835 Ga0070699_1005498351 142
72 3300005543 Ga0070672_101034222 Ga0070672_1010342221 142
73 3300005545 Ga0070695_100651266 Ga0070695_1006512662 142
74 3300005547 Ga0070693_101174506 Ga0070693_1011745061 142
75 3300005548 Ga0070665_100017030 Ga0070665_1000170305 142
76 3300005549 Ga0070704_100265765 Ga0070704_1002657652 142
77 3300005578 Ga0068854_101126324 Ga0068854_1011263241 142
78 3300005617 Ga0068859_100027669 Ga0068859_1000276693 142
79 3300005718 Ga0068866_10067224 Ga0068866_100672241 142
80 3300005719 Ga0068861_100477283 Ga0068861_1004772832 142
81 3300005841 Ga0068863_100206040 Ga0068863_1002060402 142
82 3300005842 Ga0068858_100052480 Ga0068858_1000524802 142
83 3300005842 Ga0068858_101042943 Ga0068858_1010429432 142
84 3300005843 Ga0068860_100479440 Ga0068860_1004794402 142
85 3300006237 Ga0097621_100040193 Ga0097621_1000401932 142
86 3300006358 Ga0068871_100049134 Ga0068871_1000491342 142
87 3300006871 Ga0075434_100542627 Ga0075434_1005426272 142
88 3300006881 Ga0068865_100045895 Ga0068865_1000458952 142
89 3300006881 Ga0068865_100293026 Ga0068865_1002930262 142
90 3300006931 Ga0097620_100027669 Ga0097620_1000276693 142
91 3300009098 Ga0105245_10141571 Ga0105245_101415713 142
92 3300009148 Ga0105243_11231844 Ga0105243_112318442 142
93 3300009174 Ga0105241_11805690 Ga0105241_118056901 142
94 3300009176 Ga0105242_10015208 Ga0105242_100152082 142
95 3300009176 Ga0105242_10052642 Ga0105242_100526422 142
96 3300009177 Ga0105248_10077620 Ga0105248_100776202 142
97 3300009177 Ga0105248_10427347 Ga0105248_104273472 142
98 3300009177 Ga0105248_11162632 Ga0105248_111626322 142
99 3300009551 Ga0105238_10518274 Ga0105238_105182742 142
100 3300013297 Ga0157378_10100619 Ga0157378_101006192 142
101 3300013297 Ga0157378_11116851 Ga0157378_111168512 142
102 3300013308 Ga0157375_10563576 Ga0157375_105635761 142
103 3300025899 Ga0207642_10060424 Ga0207642_100604242 142
104 3300025901 Ga0207688_10372259 Ga0207688_103722591 142
105 3300025903 Ga0207680_10175723 Ga0207680_101757232 142
106 3300025927 Ga0207687_10093538 Ga0207687_100935383 142
107 3300025928 Ga0207700_10708475 Ga0207700_107084752 142
108 3300025934 Ga0207686_10121080 Ga0207686_101210802 142
109 3300025938 Ga0207704_10051372 Ga0207704_100513722 142
110 3300025941 Ga0207711_10219627 Ga0207711_102196272 142
111 3300025941 Ga0207711_10646313 Ga0207711_106463132 142
112 3300025942 Ga0207689_10245951 Ga0207689_102459512 142
113 3300025960 Ga0207651_10090190 Ga0207651_100901902 142
114 3300025960 Ga0207651_10247637 Ga0207651_102476372 142
115 3300025986 Ga0207658_11436957 Ga0207658_114369571 142
116 3300026023 Ga0207677_10072518 Ga0207677_100725183 142
117 3300026035 Ga0207703_10318369 Ga0207703_103183692 142
118 3300026088 Ga0207641_10033760 Ga0207641_100337603 142
119 3300026089 Ga0207648_10078934 Ga0207648_100789343 142
120 3300026118 Ga0207675_100534648 Ga0207675_1005346482 142
121 3300028379 Ga0268266_10025989 Ga0268266_100259892 142
122 3300035170 Ga0373943_0495238 Ga0373943_0495238_84_572 142
123 3300035410 Ga0373924_0136248 Ga0373924_0136248_446_934 142
124 3300035725 Ga0373947_0511624 Ga0373947_0511624_203_691 142
125 3300036401 Ga0373937_0226078 Ga0373937_0226078_1216_1704 142
126 3300046472 Ga0495580_0229840 Ga0495580_0229840_547_1035 142
127 3300046473 Ga0495582_0247825 Ga0495582_0247825_32_520 142
128 3300046475 Ga0495639_0111277 Ga0495639_0111277_544_1032 142
129 3300046499 Ga0495594_0562755 Ga0495594_0562755_38_526 142
130 3300046531 Ga0495665_0225238 Ga0495665_0225238_400_888 142
131 3300046642 Ga0495634_0185418 Ga0495634_0185418_21_509 142
132 3300046683 Ga0495658_0046650 Ga0495658_0046650_973_1461 142
133 3300048907 Ga0496104_0252236 Ga0496104_0252236_245_733 142
134 3300048908 Ga0496105_0636567 Ga0496105_0636567_28_516 142
135 3300048911 Ga0496108_0846428 Ga0496108_0846428_185_673 142
136 3300048917 Ga0496114_0533662 Ga0496114_0533662_200_688 142
137 3300050512 nmdc:mga0n895_399572_c1 nmdc:mga0n895_399572_c1_92_583 142
138 3300053085 Ga0495619_0176445 Ga0495619_0176445_567_1055 142
139 3300005367 Ga0070667_101078909 Ga0070667_1010789091 143
140 3300005435 Ga0070714_100426634 Ga0070714_1004266341 143
141 3300005437 Ga0070710_10162708 Ga0070710_101627081 143
142 3300005437 Ga0070710_10476514 Ga0070710_104765142 143
143 3300005439 Ga0070711_100001604 Ga0070711_1000016046 143
144 3300005467 Ga0070706_100058013 Ga0070706_1000580136 143
145 3300005471 Ga0070698_100017941 Ga0070698_10001794110 143
146 3300006058 Ga0075432_10006180 Ga0075432_100061801 143
147 3300006175 Ga0070712_100094511 Ga0070712_1000945112 143
148 3300006358 Ga0068871_100407359 Ga0068871_1004073591 143
149 3300006871 Ga0075434_101002305 Ga0075434_1010023052 143
150 3300007265 Ga0099794_10076157 Ga0099794_100761573 143
151 3300025910 Ga0207684_10049013 Ga0207684_100490135 143
152 3300025916 Ga0207663_10006909 Ga0207663_100069094 143
153 3300025918 Ga0207662_10181492 Ga0207662_101814922 143
154 3300025929 Ga0207664_11083587 Ga0207664_110835871 143
155 3300026023 Ga0207677_10983460 Ga0207677_109834601 143
156 3300026035 Ga0207703_10544559 Ga0207703_105445591 143
157 3300027671 Ga0209588_1005977 Ga0209588_10059774 143
158 3300031090 Ga0265760_10001376 Ga0265760_100013761 143
159 3300031090 Ga0265760_10006173 Ga0265760_100061733 143
160 3300031240 Ga0265320_10234727 Ga0265320_102347271 143
161 3300035117 Ga0373953_0259786 Ga0373953_0259786_153_644 143
162 3300046454 Ga0495592_0578473 Ga0495592_0578473_10_507 143
163 3300046516 Ga0495628_0023591 Ga0495628_0023591_3031_3528 143
164 3300046517 Ga0495630_0831999 Ga0495630_0831999_132_674 143
165 3300046533 Ga0495640_0645856 Ga0495640_0645856_71_562 143
166 3300046543 Ga0495645_0002784 Ga0495645_0002784_3115_3612 143
167 3300046680 Ga0495646_0167376 Ga0495646_0167376_564_1061 143
168 3300047319 Ga0495674_0178779 Ga0495674_0178779_524_1021 143
169 3300048908 Ga0496105_0091920 Ga0496105_0091920_1017_1514 143
170 3300050512 nmdc:mga0n895_895766_c1 nmdc:mga0n895_895766_c1_356_838 143
171 3300053078 Ga0495612_0132646 Ga0495612_0132646_344_841 143
172 3300005331 Ga0070670_100434005 Ga0070670_1004340051 144
173 3300005340 Ga0070689_100169476 Ga0070689_1001694762 144
174 3300005344 Ga0070661_100637207 Ga0070661_1006372072 144
175 3300005353 Ga0070669_100092059 Ga0070669_1000920592 144
176 3300005354 Ga0070675_100144327 Ga0070675_1001443272 144
177 3300005441 Ga0070700_100290440 Ga0070700_1002904401 144
178 3300005466 Ga0070685_11187333 Ga0070685_111873331 144
179 3300005564 Ga0070664_100044258 Ga0070664_1000442584 144
180 3300005617 Ga0068859_101314978 Ga0068859_1013149781 144
181 3300006881 Ga0068865_100838090 Ga0068865_1008380902 144
182 3300006931 Ga0097620_101315141 Ga0097620_1013151411 144
183 3300025315 Ga0207697_10522601 Ga0207697_105226011 144
184 3300025923 Ga0207681_10674397 Ga0207681_106743972 144
185 3300025925 Ga0207650_10273589 Ga0207650_102735892 144
186 3300025926 Ga0207659_10036028 Ga0207659_100360282 144
187 3300025940 Ga0207691_10655817 Ga0207691_106558171 144
188 3300025945 Ga0207679_10078573 Ga0207679_100785732 144
189 3300026075 Ga0207708_10137941 Ga0207708_101379412 144
190 3300026121 Ga0207683_10154315 Ga0207683_101543153 144
191 3300028380 Ga0268265_10191937 Ga0268265_101919372 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

35

160

0.95

Feature Viewer

pLDDT pTM Quality
59.54 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map