F294474

General Info

Members Datasets Scaffolds Average Seq Length
191 149 382 158

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1101109|Ga0451576_1101109_199_726
Length 175
Sequence MSRHTASVAWSRGDARFIDNRYSRRHVWRFDGGVEVPASSSPHTVPLPRSDPQAVDPEEAFVASLSSCHMLWFLSIAAKRGFRIDAYTDEAEGFLEKDADGRMAMTRVVLRPRIAFDANNTPSAVDIAAMHDEAHEKCFIANSVRTVVEIDSGTGAGGPGSSEPMQTPAAAAGNR

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
145 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 5.76
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 12.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_1101109 3300045051 Bacteria 831
2 Ga0070677_10250567 3300005333 Bacteria 879
3 Ga0070666_10500868 3300005335 Bacteria 880
4 Ga0070666_10680204 3300005335 Unclassified 754
5 Ga0070668_100828509 3300005347 Bacteria 823
6 Ga0070673_100591808 3300005364 Bacteria 1011
7 Ga0070659_100048924 3300005366 Bacteria 3323
8 Ga0070667_100105034 3300005367 Bacteria 2444
9 Ga0070710_10241521 3300005437 Bacteria 1157
10 Ga0070708_100089915 3300005445 Bacteria 2795
11 Ga0070678_101390102 3300005456 Unclassified 655
12 Ga0070681_10130875 3300005458 Bacteria 2441
13 Ga0070698_100061901 3300005471 Unclassified 3777
14 Ga0070699_100626625 3300005518 Bacteria 981
15 Ga0070679_100821451 3300005530 Bacteria 873
16 Ga0068853_100908914 3300005539 Bacteria 846
17 Ga0070696_100112833 3300005546 Bacteria 1959
18 Ga0070704_100252369 3300005549 Bacteria 1449
19 Ga0068855_101290493 3300005563 Bacteria 756
20 Ga0068855_102310318 3300005563 Unclassified 538
21 Ga0070664_100008555 3300005564 Bacteria 8279
22 Ga0068857_101149103 3300005577 Bacteria 751
23 Ga0068854_100594588 3300005578 Bacteria 944
24 Ga0068856_100563966 3300005614 Bacteria 1160
25 Ga0068856_101781612 3300005614 Unclassified 628
26 Ga0068859_102687331 3300005617 Unclassified 547
27 Ga0068861_101502307 3300005719 Bacteria 661
28 Ga0068863_100000211 3300005841 Bacteria 62338
29 Ga0068863_100186279 3300005841 Bacteria 1994
30 Ga0068858_100379515 3300005842 Bacteria 1356
31 Ga0068860_100194150 3300005843 Bacteria 1965
32 Ga0068860_101444819 3300005843 Bacteria 709
33 Ga0068862_100562833 3300005844 Bacteria 1090
34 Ga0075433_11485539 3300006852 Bacteria 585
35 Ga0075434_100031765 3300006871 Bacteria 5207
36 Ga0075434_100290490 3300006871 Unclassified 1655
37 Ga0075436_100503501 3300006914 Bacteria 886
38 Ga0097620_102687173 3300006931 Unclassified 547
39 Ga0075435_100389483 3300007076 Bacteria 1198
40 Ga0105240_10011867 3300009093 Bacteria 12094
41 Ga0105240_11961361 3300009093 Unclassified 609
42 Ga0111539_10155828 3300009094 Bacteria 2673
43 Ga0105247_10418943 3300009101 Bacteria 958
44 Ga0114129_11629650 3300009147 Bacteria 789
45 Ga0105241_10039938 3300009174 Bacteria 3540
46 Ga0105242_12601076 3300009176 Bacteria 555
47 Ga0105237_11511003 3300009545 Bacteria 678
48 Ga0105238_10081195 3300009551 Bacteria 3232
49 Ga0105238_11013109 3300009551 Bacteria 851
50 Ga0105238_11767589 3300009551 Bacteria 650
51 Ga0105249_10353909 3300009553 Bacteria 1488
52 Ga0105249_10988099 3300009553 Bacteria 910
53 Ga0105239_10003366 3300010375 Bacteria 19640
54 Ga0105239_10125120 3300010375 Unclassified 2857
55 Ga0105239_11039673 3300010375 Bacteria 942
56 Ga0157373_10232232 3300013100 Bacteria 1303
57 Ga0157371_11412028 3300013102 Bacteria 541
58 Ga0157370_10007794 3300013104 Bacteria 11605
59 Ga0157370_10329286 3300013104 Bacteria 1408
60 Ga0157374_10240193 3300013296 Bacteria 1781
61 Ga0157374_11812508 3300013296 Unclassified 636
62 Ga0157378_10790991 3300013297 Bacteria 974
63 Ga0163162_11008062 3300013306 Bacteria 942
64 Ga0157372_10297021 3300013307 Bacteria 1879
65 Ga0157372_11045724 3300013307 Bacteria 945
66 Ga0157372_11427628 3300013307 Bacteria 798
67 Ga0163163_10873535 3300014325 Unclassified 963
68 Ga0163163_12812110 3300014325 Unclassified 543
69 Ga0157380_10204123 3300014326 Bacteria 1756
70 Ga0157379_10018312 3300014968 Bacteria 6173
71 Ga0157379_10110665 3300014968 Bacteria 2467
72 Ga0157379_10119841 3300014968 Bacteria 2367
73 Ga0206353_11636999 3300020082 Bacteria 840
74 Ga0207682_10229709 3300025893 Bacteria 860
75 Ga0207680_10422933 3300025903 Unclassified 944
76 Ga0207680_10539621 3300025903 Bacteria 832
77 Ga0207654_10027406 3300025911 Bacteria 3096
78 Ga0207707_10560869 3300025912 Bacteria 970
79 Ga0207695_10020097 3300025913 Bacteria 7661
80 Ga0207695_11235255 3300025913 Unclassified 627
81 Ga0207671_10092947 3300025914 Bacteria 2275
82 Ga0207671_10182437 3300025914 Bacteria 1634
83 Ga0207657_10010833 3300025919 Bacteria 9072
84 Ga0207681_10152222 3300025923 Bacteria 1735
85 Ga0207694_10648674 3300025924 Bacteria 889
86 Ga0207650_10278946 3300025925 Bacteria 1360
87 Ga0207659_10017861 3300025926 Bacteria 4641
88 Ga0207690_10185337 3300025932 Bacteria 1570
89 Ga0207704_10984788 3300025938 Bacteria 712
90 Ga0207679_10204885 3300025945 Bacteria 1650
91 Ga0207712_10810795 3300025961 Bacteria 823
92 Ga0207640_10673568 3300025981 Bacteria 884
93 Ga0207640_11273444 3300025981 Bacteria 656
94 Ga0207703_10675709 3300026035 Bacteria 981
95 Ga0207639_10855820 3300026041 Bacteria 849
96 Ga0207639_11388111 3300026041 Unclassified 659
97 Ga0207702_10090284 3300026078 Bacteria 2681
98 Ga0207641_10000296 3300026088 Bacteria 62219
99 Ga0207675_100026119 3300026118 Bacteria 5436
100 Ga0268266_10000610 3300028379 Bacteria 48690
101 Ga0268266_10841610 3300028379 Bacteria 887
102 Ga0268265_10382229 3300028380 Bacteria 1296
103 Ga0268264_10108037 3300028381 Bacteria 2431
104 Ga0268264_10917125 3300028381 Bacteria 880
105 Ga0307511_10071941 3300030521 Bacteria 2517
106 Ga0265340_10048725 3300031247 Bacteria 2059
107 Ga0265340_10171061 3300031247 Bacteria 984
108 Ga0307408_100028986 3300031548 Bacteria 3830
109 Ga0307516_10009106 3300031730 Bacteria 11116
110 Ga0307405_10981244 3300031731 Bacteria 720
111 Ga0307410_10001824 3300031852 Bacteria 9898
112 Ga0307412_11456732 3300031911 Bacteria 621
113 Ga0307416_102226390 3300032002 Bacteria 649
114 Ga0307510_10012628 3300033180 Bacteria 10017
115 Ga0373936_0132706 3300035113 Unclassified 1071
116 Ga0373931_0068546 3300035691 Bacteria 1931
117 Ga0395905_0400538 3300037471 Bacteria 1267
118 Ga0436365_1100254 3300039437 Bacteria 1117
119 Ga0436365_1237335 3300039437 Bacteria 2564
120 Ga0436360_0113048 3300039438 Bacteria 1150
121 Ga0451577_0001162 3300042876 Bacteria 37184
122 Ga0466969_0015333 3300044656 Bacteria 4017
123 Ga0466969_0195276 3300044656 Bacteria 924
124 Ga0466966_0088597 3300044684 Bacteria 1923
125 Ga0466961_0116883 3300044693 Unclassified 1676
126 Ga0466964_0002215 3300044706 Bacteria 6878
127 Ga0453684_0000019 3300044712 Bacteria 908702
128 Ga0453684_0141990 3300044712 Bacteria 2866
129 Ga0453684_2033952 3300044712 Bacteria 578
130 Ga0466971_0441612 3300044719 Unclassified 637
131 Ga0466970_0700781 3300044765 Unclassified 590
132 Ga0451576_0044274 3300045051 Bacteria 4692
133 Ga0451576_0086882 3300045051 Bacteria 3253
134 Ga0451576_0389146 3300045051 Bacteria 1462
135 Ga0495632_0389380 3300046519 Unclassified 610
136 Ga0495642_0102453 3300046528 Bacteria 1219
137 Ga0495636_0063253 3300047318 Bacteria 1568
138 Ga0495687_100277 3300047443 Unclassified 1088
139 Ga0496102_0362778 3300048905 Bacteria 1364
140 Ga0496105_0945851 3300048908 Bacteria 647
141 Ga0496106_0473004 3300048909 Bacteria 1007
142 Ga0496108_0739799 3300048911 Bacteria 851
143 Ga0496108_1062037 3300048911 Bacteria 689
144 Ga0496109_0373736 3300048912 Bacteria 1346
145 Ga0496110_0063642 3300048913 Bacteria 3259
146 Ga0496110_0391506 3300048913 Bacteria 1267
147 Ga0496111_0354181 3300048914 Bacteria 1086
148 Ga0496113_0101806 3300048916 Bacteria 2227
149 Ga0496115_0000077 3300048918 Bacteria 89885
150 Ga0496116_0049719 3300048919 Bacteria 2800
151 Ga0496117_0000684 3300048920 Bacteria 54139
152 Ga0496118_0002247 3300048921 Bacteria 26508
153 Ga0496119_0001963 3300048922 Bacteria 23384
154 Ga0496120_0006458 3300048923 Bacteria 8993
155 Ga0496121_0016349 3300048924 Bacteria 7667
156 Ga0496124_0002600 3300048927 Bacteria 23340
157 Ga0496125_0001848 3300048928 Bacteria 29212
158 Ga0496126_0000047 3300048929 Bacteria 322212
159 Ga0496126_0004144 3300048929 Bacteria 17526
160 Ga0501040_0709004 3300049576 Bacteria 728
161 Ga0501041_0183570 3300049577 Bacteria 1310
162 Ga0501067_0059165 3300049583 Bacteria 2121
163 Ga0501070_0152002 3300049586 Bacteria 1910
164 Ga0501074_0086899 3300049590 Bacteria 2240
165 Ga0501076_1300491 3300049592 Bacteria 598
166 Ga0501079_0052006 3300049741 Bacteria 3163
167 Ga0501080_0133808 3300049742 Bacteria 2295
168 Ga0501080_0247768 3300049742 Bacteria 1625
169 Ga0501081_0023272 3300049743 Bacteria 4152
170 Ga0501083_0582611 3300049744 Bacteria 728
171 Ga0501035_0176905 3300049822 Bacteria 1840
172 Ga0501044_0033436 3300049823 Bacteria 5405
173 nmdc:mga05p37_369409_c1 3300050507 Bacteria 1684
174 nmdc:mga06r32_58023_c1 3300050510 Bacteria 3720
175 nmdc:mga08y16_167990_c1 3300050511 Bacteria 2279
176 nmdc:mga0n895_105953_c1 3300050512 Bacteria 2824
177 nmdc:mga0n895_133891_c1 3300050512 Bacteria 2504
178 nmdc:mga0rr50_504423_c1 3300050513 Bacteria 1029
179 nmdc:mga08x19_453380_c1 3300050514 Bacteria 903
180 nmdc:mga0a205_1148263_c1 3300050515 Bacteria 624
181 nmdc:mga0a205_57126_c1 3300050515 Bacteria 2569
182 Ga0500610_0000360 3300053079 Bacteria 13753
183 Ga0500568_0002225 3300053139 Bacteria 11649
184 Ga0500590_112508 3300053148 Unclassified 1289
185 Ga0500604_0000488 3300053151 Bacteria 10942
186 Ga0500616_0000080 3300053153 Bacteria 200381
187 Ga0500637_0249508 3300053178 Bacteria 991
188 Ga0501082_0624188 3300060353 Bacteria 943
189 Ga0501082_0811241 3300060353 Bacteria 819
190 Ga0501082_1140138 3300060353 Bacteria 682
191 Ga0530510_0997390 3300061734 Bacteria 641
192 Ga0451576_1101109
193 Ga0070677_10250567
194 Ga0070666_10500868
195 Ga0070666_10680204
196 Ga0070668_100828509
197 Ga0070673_100591808
198 Ga0070659_100048924
199 Ga0070667_100105034
200 Ga0070710_10241521
201 Ga0070708_100089915
202 Ga0070678_101390102
203 Ga0070681_10130875
204 Ga0070698_100061901
205 Ga0070699_100626625
206 Ga0070679_100821451
207 Ga0068853_100908914
208 Ga0070696_100112833
209 Ga0070704_100252369
210 Ga0068855_101290493
211 Ga0068855_102310318
212 Ga0070664_100008555
213 Ga0068857_101149103
214 Ga0068854_100594588
215 Ga0068856_100563966
216 Ga0068856_101781612
217 Ga0068859_102687331
218 Ga0068861_101502307
219 Ga0068863_100000211
220 Ga0068863_100186279
221 Ga0068858_100379515
222 Ga0068860_100194150
223 Ga0068860_101444819
224 Ga0068862_100562833
225 Ga0075433_11485539
226 Ga0075434_100031765
227 Ga0075434_100290490
228 Ga0075436_100503501
229 Ga0097620_102687173
230 Ga0075435_100389483
231 Ga0105240_10011867
232 Ga0105240_11961361
233 Ga0111539_10155828
234 Ga0105247_10418943
235 Ga0114129_11629650
236 Ga0105241_10039938
237 Ga0105242_12601076
238 Ga0105237_11511003
239 Ga0105238_10081195
240 Ga0105238_11013109
241 Ga0105238_11767589
242 Ga0105249_10353909
243 Ga0105249_10988099
244 Ga0105239_10003366
245 Ga0105239_10125120
246 Ga0105239_11039673
247 Ga0157373_10232232
248 Ga0157371_11412028
249 Ga0157370_10007794
250 Ga0157370_10329286
251 Ga0157374_10240193
252 Ga0157374_11812508
253 Ga0157378_10790991
254 Ga0163162_11008062
255 Ga0157372_10297021
256 Ga0157372_11045724
257 Ga0157372_11427628
258 Ga0163163_10873535
259 Ga0163163_12812110
260 Ga0157380_10204123
261 Ga0157379_10018312
262 Ga0157379_10110665
263 Ga0157379_10119841
264 Ga0206353_11636999
265 Ga0207682_10229709
266 Ga0207680_10422933
267 Ga0207680_10539621
268 Ga0207654_10027406
269 Ga0207707_10560869
270 Ga0207695_10020097
271 Ga0207695_11235255
272 Ga0207671_10092947
273 Ga0207671_10182437
274 Ga0207657_10010833
275 Ga0207681_10152222
276 Ga0207694_10648674
277 Ga0207650_10278946
278 Ga0207659_10017861
279 Ga0207690_10185337
280 Ga0207704_10984788
281 Ga0207679_10204885
282 Ga0207712_10810795
283 Ga0207640_10673568
284 Ga0207640_11273444
285 Ga0207703_10675709
286 Ga0207639_10855820
287 Ga0207639_11388111
288 Ga0207702_10090284
289 Ga0207641_10000296
290 Ga0207675_100026119
291 Ga0268266_10000610
292 Ga0268266_10841610
293 Ga0268265_10382229
294 Ga0268264_10108037
295 Ga0268264_10917125
296 Ga0307511_10071941
297 Ga0265340_10048725
298 Ga0265340_10171061
299 Ga0307408_100028986
300 Ga0307516_10009106
301 Ga0307405_10981244
302 Ga0307410_10001824
303 Ga0307412_11456732
304 Ga0307416_102226390
305 Ga0307510_10012628
306 Ga0373936_0132706
307 Ga0373931_0068546
308 Ga0395905_0400538
309 Ga0436365_1100254
310 Ga0436365_1237335
311 Ga0436360_0113048
312 Ga0451577_0001162
313 Ga0466969_0015333
314 Ga0466969_0195276
315 Ga0466966_0088597
316 Ga0466961_0116883
317 Ga0466964_0002215
318 Ga0453684_0000019
319 Ga0453684_0141990
320 Ga0453684_2033952
321 Ga0466971_0441612
322 Ga0466970_0700781
323 Ga0451576_0044274
324 Ga0451576_0086882
325 Ga0451576_0389146
326 Ga0495632_0389380
327 Ga0495642_0102453
328 Ga0495636_0063253
329 Ga0495687_100277
330 Ga0496102_0362778
331 Ga0496105_0945851
332 Ga0496106_0473004
333 Ga0496108_0739799
334 Ga0496108_1062037
335 Ga0496109_0373736
336 Ga0496110_0063642
337 Ga0496110_0391506
338 Ga0496111_0354181
339 Ga0496113_0101806
340 Ga0496115_0000077
341 Ga0496116_0049719
342 Ga0496117_0000684
343 Ga0496118_0002247
344 Ga0496119_0001963
345 Ga0496120_0006458
346 Ga0496121_0016349
347 Ga0496124_0002600
348 Ga0496125_0001848
349 Ga0496126_0000047
350 Ga0496126_0004144
351 Ga0501040_0709004
352 Ga0501041_0183570
353 Ga0501067_0059165
354 Ga0501070_0152002
355 Ga0501074_0086899
356 Ga0501076_1300491
357 Ga0501079_0052006
358 Ga0501080_0133808
359 Ga0501080_0247768
360 Ga0501081_0023272
361 Ga0501083_0582611
362 Ga0501035_0176905
363 Ga0501044_0033436
364 nmdc:mga05p37_369409_c1
365 nmdc:mga06r32_58023_c1
366 nmdc:mga08y16_167990_c1
367 nmdc:mga0n895_105953_c1
368 nmdc:mga0n895_133891_c1
369 nmdc:mga0rr50_504423_c1
370 nmdc:mga08x19_453380_c1
371 nmdc:mga0a205_1148263_c1
372 nmdc:mga0a205_57126_c1
373 Ga0500610_0000360
374 Ga0500568_0002225
375 Ga0500590_112508
376 Ga0500604_0000488
377 Ga0500616_0000080
378 Ga0500637_0249508
379 Ga0501082_0624188
380 Ga0501082_0811241
381 Ga0501082_1140138
382 Ga0530510_0997390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

50

152

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9849 1 153
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9723 1 153
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8576 1 153
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8354 1 153
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8313 1 157
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9783 2 153 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.972 2 153 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8352 54 156 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8311 7 153 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.827 56 152 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A078BH89-F1-model_v4 OsmC family protein (Modular protein) 0.9956 1 154
AF-A0A1E4J6V7-F1-model_v4 Peroxiredoxin 0.9949 1 154
AF-A0A3N7CUJ4-F1-model_v4 Peroxiredoxin 0.9947 1 154
AF-A0A1C3XWS3-F1-model_v4 Organic hydroperoxide reductase OsmC/OhrA 0.9942 1 154
AF-A0A0J1GHH4-F1-model_v4 Peroxiredoxin 0.994 54 154

Map