F294256

General Info

Members Datasets Scaffolds Average Seq Length
191 147 174 451

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10008045|Ga0265314_100080456
Length 512
Sequence MIAMSEAAKTANRVAVLRPVFMGDFNPSLREAEFYQRTLRKCATAAVSCGCSGMSFSHSIGARMYTFASLRELLAKATPLRSGDVLAGVAAATAEERVAAQFALADLPLAHFCAEQVVPYETDEVTRLIVDTHDAEAFAPVRSFTVGELRDWLLSDEATGERIAALSPGLTPEMAAAVSKLMRVQDLIAAARKIRVVTRFRTTVGLEGRLSARLQPNHPTDAPVGIAASILDGLLMGSGDAVVGINPAADSVASTTGLLRMIDALRQRFSIPMQSCVLAHITTQMAALEAGAPVDLIFQSIAGTEAANRSFGVSLSLLREAHEAGKGLRRGAVCADGSVGQNVMYFETGQGSALSAGAHIGVGGMGVDQQTLEARAYAVALHFNPMLVNTVVGFIGPEYLYDGKQIIRAGLEDHFCGKLMGLPMGCDVCYTNHAEADQDGAAGVNYIMGVPGADDVMLNYQSTSFHDALYVRRILGLRPAPEFEAWMQGDGFRRLALEAGNPEGLPERLLTA

Samples

Sample ID Description Type Environment
1 2511231023 Pseudomonas sp. GM80 Isolate Nodule
2 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
3 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
4 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
5 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
6 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
7 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
8 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
9 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
10 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
11 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
12 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
13 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
14 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
15 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
16 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.1
Metatranscriptomes 0
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.9
Nodule 0.52
Rhizoplane 3.66
Rhizosphere 74.35
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008859 3300001979 Bacteria 3986
2 JGI25155J39150_1000202 3300002704 Bacteria 24699
3 JGI25162J39368_1000122 3300002737 Bacteria 85129
4 JGI25154J39366_1000100 3300002738 Bacteria 76811
5 JGI25164J39214_1000099 3300002772 Bacteria 85129
6 JGI25406J46586_10000271 3300003203 Bacteria 23123
7 JGI25165J46597_1000205 3300003214 Bacteria 85129
8 JGI25153J46596_10002275 3300003215 Bacteria 11192
9 JGI25160J50197_1002448 3300003354 Bacteria 8636
10 Ga0065712_10069723 3300005290 Bacteria 6806
11 Ga0070658_10010426 3300005327 Bacteria 7451
12 Ga0070683_100000031 3300005329 Bacteria 150779
13 Ga0070683_100009800 3300005329 Bacteria 8207
14 Ga0070660_100000115 3300005339 Bacteria 49912
15 Ga0070659_100000170 3300005366 Bacteria 50095
16 Ga0070714_100092407 3300005435 Bacteria 2652
17 Ga0070663_100003229 3300005455 Bacteria 9375
18 Ga0070679_100107320 3300005530 Bacteria 2778
19 Ga0070684_100000030 3300005535 Bacteria 107248
20 Ga0068853_100149608 3300005539 Bacteria 2101
21 Ga0068855_100084220 3300005563 Bacteria 3682
22 Ga0068852_100001414 3300005616 Bacteria 16193
23 Ga0068858_100130444 3300005842 Bacteria 2357
24 Ga0075370_10039141 3300006353 Bacteria 2671
25 Ga0099794_10004793 3300007265 Bacteria 5367
26 Ga0105251_10000016 3300009011 Bacteria 146400
27 Ga0105251_10000456 3300009011 Bacteria 39260
28 Ga0105251_10007660 3300009011 Bacteria 6606
29 Ga0105244_10000154 3300009036 Bacteria 72483
30 Ga0105240_10001633 3300009093 Bacteria 38062
31 Ga0105240_10129350 3300009093 Bacteria 3030
32 Ga0105247_10017736 3300009101 Bacteria 4269
33 Ga0105243_10000188 3300009148 Bacteria 71863
34 Ga0105243_10009171 3300009148 Bacteria 7554
35 Ga0105237_10001870 3300009545 Bacteria 26860
36 Ga0105238_10011215 3300009551 Bacteria 9016
37 Ga0105238_10019579 3300009551 Bacteria 6892
38 Ga0105239_10061327 3300010375 Bacteria 4127
39 Ga0157371_10004423 3300013102 Bacteria 12271
40 Ga0182008_10002633 3300014497 Bacteria 11134
41 Ga0157379_10181569 3300014968 Bacteria 1901
42 Ga0182007_10001915 3300015262 Bacteria 10797
43 Ga0213875_10016554 3300021388 Bacteria 3573
44 Ga0209760_100060 3300025207 Bacteria 97274
45 Ga0207427_100056 3300025231 Bacteria 204343
46 Ga0209437_100065 3300025233 Bacteria 332417
47 Ga0209646_1000006 3300025246 Bacteria 694084
48 Ga0209026_1000359 3300025250 Bacteria 42889
49 Ga0209233_1000085 3300025261 Bacteria 333078
50 Ga0209758_1006236 3300025297 Bacteria 8697
51 Ga0207426_1000209 3300025302 Bacteria 139524
52 Ga0209051_1005254 3300025303 Bacteria 7634
53 Ga0207655_1000104 3300025728 Bacteria 184765
54 Ga0207655_1002652 3300025728 Bacteria 14109
55 Ga0207713_1009171 3300025735 Bacteria 5604
56 Ga0207647_10003444 3300025904 Bacteria 11871
57 Ga0207707_10075873 3300025912 Bacteria 2934
58 Ga0207695_10005319 3300025913 Bacteria 17141
59 Ga0207695_10005758 3300025913 Bacteria 16314
60 Ga0207671_10004068 3300025914 Bacteria 14167
61 Ga0207671_10016547 3300025914 Bacteria 5727
62 Ga0207657_10000016 3300025919 Bacteria 175206
63 Ga0207694_10011917 3300025924 Bacteria 6556
64 Ga0207690_10000012 3300025932 Bacteria 269610
65 Ga0207709_10000265 3300025935 Bacteria 61850
66 Ga0207709_10043413 3300025935 Bacteria 2710
67 Ga0207661_10000012 3300025944 Bacteria 354345
68 Ga0207661_10164070 3300025944 Bacteria 1929
69 Ga0207667_10085327 3300025949 Bacteria 3269
70 Ga0207703_10126091 3300026035 Bacteria 2204
71 Ga0207678_10000269 3300026067 Bacteria 47203
72 Ga0209995_1004298 3300027471 Bacteria 2277
73 Ga0265323_10018636 3300028653 Bacteria 2684
74 Ga0265338_10006603 3300028800 Bacteria 14704
75 Ga0265338_10008491 3300028800 Bacteria 12460
76 Ga0265332_10011385 3300031238 Bacteria 3954
77 Ga0265332_10014590 3300031238 Bacteria 3476
78 Ga0265325_10000362 3300031241 Bacteria 31826
79 Ga0265339_10000011 3300031249 Bacteria 206284
80 Ga0265339_10002185 3300031249 Bacteria 14193
81 Ga0265331_10000029 3300031250 Bacteria 215441
82 Ga0265331_10016078 3300031250 Bacteria 3937
83 Ga0265331_10024146 3300031250 Bacteria 3080
84 Ga0265316_10007663 3300031344 Bacteria 10129
85 Ga0265313_10000153 3300031595 Bacteria 71704
86 Ga0265314_10000800 3300031711 Bacteria 37327
87 Ga0265314_10008045 3300031711 Bacteria 9087
88 Ga0265342_10001377 3300031712 Bacteria 22700
89 Ga0265342_10007886 3300031712 Bacteria 7725
90 Ga0265342_10078944 3300031712 Bacteria 1904
91 Ga0307516_10000508 3300031730 Bacteria 51902
92 Ga0307416_100089062 3300032002 Bacteria 2641
93 Ga0307414_10091724 3300032004 Bacteria 2259
94 Ga0373927_0029268 3300035695 Bacteria 3589
95 Ga0436361_1028837 3300039447 Bacteria 4711
96 Ga0439455_0009495 3300042012 Bacteria 2113
97 Ga0466961_0071961 3300044693 Bacteria 2193
98 Ga0451576_0001637 3300045051 Bacteria 37429
99 Ga0451576_0019615 3300045051 Bacteria 7379
100 Ga0451576_0058214 3300045051 Bacteria 4039
101 Ga0495627_000014 3300046453 Bacteria 326114
102 Ga0495627_000037 3300046453 Bacteria 198542
103 Ga0495592_0083676 3300046454 Bacteria 2303
104 Ga0495591_000189 3300046458 Bacteria 63919
105 Ga0495591_002014 3300046458 Bacteria 11822
106 Ga0495651_0096597 3300046462 Bacteria 2207
107 Ga0495653_0095829 3300046463 Bacteria 2159
108 Ga0495650_0002718 3300046471 Bacteria 13714
109 Ga0495650_0012594 3300046471 Bacteria 4538
110 Ga0495605_0000124 3300046474 Bacteria 101623
111 Ga0495664_0006784 3300046477 Bacteria 6333
112 Ga0495584_0000252 3300046491 Bacteria 38603
113 Ga0495607_0000674 3300046501 Bacteria 32994
114 Ga0495607_0000678 3300046501 Bacteria 32939
115 Ga0495607_0001057 3300046501 Bacteria 25153
116 Ga0495607_0010541 3300046501 Bacteria 6208
117 Ga0495583_0000874 3300046506 Bacteria 36528
118 Ga0495583_0001159 3300046506 Bacteria 28688
119 Ga0495583_0011462 3300046506 Bacteria 5087
120 Ga0495583_0054717 3300046506 Bacteria 1805
121 Ga0495606_0000032 3300046507 Bacteria 248690
122 Ga0495606_0007519 3300046507 Bacteria 9720
123 Ga0495610_0017247 3300046512 Bacteria 4122
124 Ga0495618_0056668 3300046514 Bacteria 2481
125 Ga0495620_0003303 3300046515 Bacteria 9250
126 Ga0495631_0000400 3300046518 Bacteria 29980
127 Ga0495632_0001045 3300046519 Bacteria 23846
128 Ga0495632_0001408 3300046519 Bacteria 20097
129 Ga0495632_0014937 3300046519 Bacteria 4373
130 Ga0495637_0014608 3300046520 Bacteria 3702
131 Ga0495637_0023065 3300046520 Bacteria 2832
132 Ga0495652_0003474 3300046529 Bacteria 15537
133 Ga0495654_0000904 3300046530 Bacteria 22122
134 Ga0495645_0005473 3300046543 Bacteria 8722
135 Ga0495645_0020437 3300046543 Bacteria 4776
136 Ga0495645_0133698 3300046543 Bacteria 1736
137 Ga0495622_0000129 3300046557 Bacteria 65178
138 Ga0495656_0000072 3300046615 Bacteria 45119
139 Ga0495668_0018684 3300046616 Bacteria 4006
140 Ga0495661_0000140 3300046665 Bacteria 85015
141 Ga0495661_0000580 3300046665 Bacteria 37833
142 Ga0495661_0015408 3300046665 Bacteria 5102
143 Ga0495599_0000569 3300046678 Bacteria 21086
144 Ga0495599_0014247 3300046678 Bacteria 4922
145 Ga0495646_0010904 3300046680 Bacteria 5773
146 Ga0495604_0012418 3300047317 Bacteria 6772
147 Ga0495672_0000669 3300047320 Bacteria 38008
148 Ga0495672_0020012 3300047320 Bacteria 4397
149 Ga0495672_0044938 3300047320 Bacteria 2647
150 Ga0495683_0000049 3300047323 Bacteria 124659
151 Ga0495673_0025958 3300047469 Bacteria 2808
152 Ga0495684_0122507 3300047471 Bacteria 1957
153 Ga0496102_0034472 3300048905 Bacteria 4553
154 Ga0496105_0076192 3300048908 Bacteria 2770
155 Ga0496109_0003646 3300048912 Bacteria 12871
156 Ga0496111_0108706 3300048914 Bacteria 2042
157 Ga0496116_0000398 3300048919 Bacteria 63093
158 Ga0496117_0050592 3300048920 Bacteria 2945
159 Ga0496118_0068620 3300048921 Bacteria 2573
160 Ga0496118_0102012 3300048921 Bacteria 1935
161 Ga0496121_0000412 3300048924 Bacteria 84946
162 Ga0496122_0008529 3300048925 Bacteria 11026
163 Ga0496123_0001842 3300048926 Bacteria 27837
164 Ga0496124_0000009 3300048927 Bacteria 734820
165 Ga0496125_0000040 3300048928 Bacteria 314478
166 Ga0496125_0065980 3300048928 Bacteria 2863
167 Ga0496126_0087765 3300048929 Bacteria 2741
168 Ga0495682_0000185 3300049460 Bacteria 50990
169 Ga0501225_0000400 3300049705 Bacteria 13739
170 Ga0501226_000032 3300049853 Bacteria 73400
171 Ga0500618_000263 3300053125 Bacteria 40698
172 Ga0500618_000512 3300053125 Bacteria 24567
173 Ga0500652_011547 3300053131 Bacteria 3064
174 Ga0500622_0029427 3300053156 Bacteria 2889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10007660 Ga0105251_100076606 414
2 3300009148 Ga0105243_10009171 Ga0105243_100091713 414
3 3300025728 Ga0207655_1000104 Ga0207655_100010468 414
4 3300025735 Ga0207713_1009171 Ga0207713_10091716 414
5 3300046501 Ga0495607_0000674 Ga0495607_0000674_27935_29329 414
6 3300046501 Ga0495607_0010541 Ga0495607_0010541_4466_5860 414
7 3300002737 JGI25162J39368_1000122 JGI25162J39368_100012252 416
8 3300002772 JGI25164J39214_1000099 JGI25164J39214_100009952 416
9 3300003214 JGI25165J46597_1000205 JGI25165J46597_100020552 416
10 3300009148 Ga0105243_10000188 Ga0105243_1000018835 416
11 3300013102 Ga0157371_10004423 Ga0157371_100044235 416
12 3300014497 Ga0182008_10002633 Ga0182008_100026335 416
13 3300025207 Ga0209760_100060 Ga0209760_10006053 416
14 3300025231 Ga0207427_100056 Ga0207427_10005685 416
15 3300025233 Ga0209437_100065 Ga0209437_10006585 416
16 3300025261 Ga0209233_1000085 Ga0209233_100008585 416
17 3300025935 Ga0207709_10000265 Ga0207709_1000026531 416
18 3300048919 Ga0496116_0000398 Ga0496116_0000398_21498_22892 416
19 3300048920 Ga0496117_0050592 Ga0496117_0050592_759_2153 416
20 3300048921 Ga0496118_0068620 Ga0496118_0068620_990_2384 416
21 3300048924 Ga0496121_0000412 Ga0496121_0000412_46891_48285 416
22 3300048925 Ga0496122_0008529 Ga0496122_0008529_6201_7595 416
23 3300048926 Ga0496123_0001842 Ga0496123_0001842_20534_21928 416
24 3300046462 Ga0495651_0096597 Ga0495651_0096597_575_1861 419
25 3300046463 Ga0495653_0095829 Ga0495653_0095829_289_1575 419
26 3300046477 Ga0495664_0006784 Ga0495664_0006784_4346_5632 419
27 3300046514 Ga0495618_0056668 Ga0495618_0056668_494_1780 419
28 3300046543 Ga0495645_0005473 Ga0495645_0005473_3103_4389 419
29 3300046678 Ga0495599_0014247 Ga0495599_0014247_2470_3756 419
30 3300046680 Ga0495646_0010904 Ga0495646_0010904_930_2216 419
31 3300047317 Ga0495604_0012418 Ga0495604_0012418_2604_3890 419
32 3300047471 Ga0495684_0122507 Ga0495684_0122507_325_1611 419
33 3300005329 Ga0070683_100000031 Ga0070683_10000003135 420
34 3300005535 Ga0070684_100000030 Ga0070684_10000003065 420
35 3300025944 Ga0207661_10000012 Ga0207661_10000012113 420
36 3300005329 Ga0070683_100009800 Ga0070683_1000098003 428
37 3300005530 Ga0070679_100107320 Ga0070679_1001073202 428
38 3300009093 Ga0105240_10001633 Ga0105240_1000163323 428
39 3300009093 Ga0105240_10129350 Ga0105240_101293502 428
40 3300009545 Ga0105237_10001870 Ga0105237_100018706 428
41 3300025912 Ga0207707_10075873 Ga0207707_100758732 428
42 3300025913 Ga0207695_10005319 Ga0207695_1000531915 428
43 3300025913 Ga0207695_10005758 Ga0207695_100057587 428
44 3300025914 Ga0207671_10004068 Ga0207671_100040683 428
45 3300025944 Ga0207661_10164070 Ga0207661_101640702 428
46 3300045051 Ga0451576_0019615 Ga0451576_0019615_1335_2624 428
47 3300025949 Ga0207667_10085327 Ga0207667_100853271 429
48 3300045051 Ga0451576_0058214 Ga0451576_0058214_1847_3139 429
49 3300045051 Ga0451576_0001637 Ga0451576_0001637_8751_10118 432
50 3300005290 Ga0065712_10069723 Ga0065712_100697237 436
51 3300009036 Ga0105244_10000154 Ga0105244_1000015424 436
52 3300025728 Ga0207655_1002652 Ga0207655_100265210 436
53 3300025935 Ga0207709_10043413 Ga0207709_100434132 436
54 3300046453 Ga0495627_000037 Ga0495627_000037_95188_96582 436
55 3300046458 Ga0495591_002014 Ga0495591_002014_5281_6675 436
56 3300046506 Ga0495583_0011462 Ga0495583_0011462_397_1791 436
57 3300046519 Ga0495632_0001408 Ga0495632_0001408_270_1664 436
58 3300046520 Ga0495637_0014608 Ga0495637_0014608_253_1647 436
59 3300046665 Ga0495661_0000140 Ga0495661_0000140_83020_84414 436
60 3300047320 Ga0495672_0020012 Ga0495672_0020012_766_2160 436
61 3300006353 Ga0075370_10039141 Ga0075370_100391413 437
62 3300048929 Ga0496126_0087765 Ga0496126_0087765_869_2257 437
63 3300032002 Ga0307416_100089062 Ga0307416_1000890622 440
64 3300032004 Ga0307414_10091724 Ga0307414_100917242 440
65 3300028800 Ga0265338_10008491 Ga0265338_100084917 441
66 3300031249 Ga0265339_10000011 Ga0265339_10000011116 441
67 3300031250 Ga0265331_10016078 Ga0265331_100160781 441
68 3300031711 Ga0265314_10008045 Ga0265314_100080456 441
69 3300031712 Ga0265342_10007886 Ga0265342_100078865 441
70 3300039447 Ga0436361_1028837 Ga0436361_1028837_1067_2467 441
71 3300003203 JGI25406J46586_10000271 JGI25406J46586_100002719 446
72 iso_pu_bacteria 2883577096 2883579199 447
73 3300005339 Ga0070660_100000115 Ga0070660_10000011529 448
74 3300005366 Ga0070659_100000170 Ga0070659_1000001703 448
75 3300005455 Ga0070663_100003229 Ga0070663_1000032295 448
76 3300005539 Ga0068853_100149608 Ga0068853_1001496082 448
77 3300005563 Ga0068855_100084220 Ga0068855_1000842202 448
78 3300005616 Ga0068852_100001414 Ga0068852_1000014146 448
79 3300009551 Ga0105238_10019579 Ga0105238_100195794 448
80 3300021388 Ga0213875_10016554 Ga0213875_100165543 448
81 3300025904 Ga0207647_10003444 Ga0207647_100034447 448
82 3300025914 Ga0207671_10016547 Ga0207671_100165474 448
83 3300025919 Ga0207657_10000016 Ga0207657_1000001625 448
84 3300025924 Ga0207694_10011917 Ga0207694_100119174 448
85 3300025932 Ga0207690_10000012 Ga0207690_10000012133 448
86 3300026067 Ga0207678_10000269 Ga0207678_100002694 448
87 3300048921 Ga0496118_0102012 Ga0496118_0102012_453_1850 448
88 3300014968 Ga0157379_10181569 Ga0157379_101815692 450
89 3300031344 Ga0265316_10007663 Ga0265316_100076633 450
90 3300031712 Ga0265342_10078944 Ga0265342_100789442 450
91 3300046471 Ga0495650_0012594 Ga0495650_0012594_1294_2685 450
92 iso_pu_bacteria 2526164512 2526211150 451
93 iso_pu_bacteria 2599185307 2599970778 451
94 iso_pu_bacteria 2600255283 2601625063 451
95 iso_pu_bacteria 2848858292 2848864140 451
96 iso_pu_bacteria 2894772417 2894773722 451
97 iso_pu_bacteria 2954767861 2954771751 451
98 iso_pu_bacteria 2511231156 2511827174 452
99 iso_pu_bacteria 2599185155 2599327224 452
100 iso_pu_bacteria 2808606373 2808905038 452
101 iso_pu_bacteria 2826581358 2826582845 452
102 iso_pu_bacteria 2842815866 2842819895 452
103 iso_pu_bacteria 2842849001 2842852861 452
104 iso_pu_bacteria 2929921140 2929924765 452
105 iso_pu_bacteria 8011350971 8011355756 452
106 3300028800 Ga0265338_10006603 Ga0265338_100066033 453
107 3300031238 Ga0265332_10011385 Ga0265332_100113853 453
108 3300031241 Ga0265325_10000362 Ga0265325_100003629 453
109 3300031249 Ga0265339_10002185 Ga0265339_100021856 453
110 3300031250 Ga0265331_10000029 Ga0265331_1000002931 453
111 3300031595 Ga0265313_10000153 Ga0265313_1000015340 453
112 3300031711 Ga0265314_10000800 Ga0265314_1000080018 453
113 3300031712 Ga0265342_10001377 Ga0265342_100013775 453
114 3300046529 Ga0495652_0003474 Ga0495652_0003474_12104_13489 453
115 3300046543 Ga0495645_0020437 Ga0495645_0020437_1614_2999 453
116 3300046678 Ga0495599_0000569 Ga0495599_0000569_12264_13649 453
117 3300048928 Ga0496125_0000040 Ga0496125_0000040_46920_48302 453
118 3300002738 JGI25154J39366_1000100 JGI25154J39366_100010012 454
119 3300003215 JGI25153J46596_10002275 JGI25153J46596_100022753 454
120 3300003354 JGI25160J50197_1002448 JGI25160J50197_10024487 454
121 3300025246 Ga0209646_1000006 Ga0209646_100000649 454
122 3300025250 Ga0209026_1000359 Ga0209026_100035912 454
123 3300025297 Ga0209758_1006236 Ga0209758_10062363 454
124 3300025302 Ga0207426_1000209 Ga0207426_100020990 454
125 3300031238 Ga0265332_10014590 Ga0265332_100145902 454
126 3300031250 Ga0265331_10024146 Ga0265331_100241461 454
127 3300002704 JGI25155J39150_1000202 JGI25155J39150_10002028 455
128 3300005435 Ga0070714_100092407 Ga0070714_1000924072 455
129 3300005842 Ga0068858_100130444 Ga0068858_1001304443 455
130 3300007265 Ga0099794_10004793 Ga0099794_100047935 455
131 3300009011 Ga0105251_10000016 Ga0105251_1000001693 455
132 3300009011 Ga0105251_10000456 Ga0105251_100004568 455
133 3300009101 Ga0105247_10017736 Ga0105247_100177362 455
134 3300009551 Ga0105238_10011215 Ga0105238_100112154 455
135 3300010375 Ga0105239_10061327 Ga0105239_100613273 455
136 3300015262 Ga0182007_10001915 Ga0182007_100019155 455
137 3300026035 Ga0207703_10126091 Ga0207703_101260913 455
138 3300027471 Ga0209995_1004298 Ga0209995_10042982 455
139 3300028653 Ga0265323_10018636 Ga0265323_100186362 455
140 3300035695 Ga0373927_0029268 Ga0373927_0029268_938_2377 455
141 3300042012 Ga0439455_0009495 Ga0439455_0009495_83_1477 455
142 3300046453 Ga0495627_000014 Ga0495627_000014_251915_253306 455
143 3300046454 Ga0495592_0083676 Ga0495592_0083676_274_1683 455
144 3300046458 Ga0495591_000189 Ga0495591_000189_25550_26941 455
145 3300046471 Ga0495650_0002718 Ga0495650_0002718_2946_4337 455
146 3300046474 Ga0495605_0000124 Ga0495605_0000124_79511_80902 455
147 3300046491 Ga0495584_0000252 Ga0495584_0000252_14344_15804 455
148 3300046501 Ga0495607_0000678 Ga0495607_0000678_12829_14220 455
149 3300046501 Ga0495607_0001057 Ga0495607_0001057_13977_15368 455
150 3300046506 Ga0495583_0000874 Ga0495583_0000874_24606_25997 455
151 3300046506 Ga0495583_0001159 Ga0495583_0001159_1311_2702 455
152 3300046506 Ga0495583_0054717 Ga0495583_0054717_338_1762 455
153 3300046507 Ga0495606_0000032 Ga0495606_0000032_227094_228485 455
154 3300046512 Ga0495610_0017247 Ga0495610_0017247_749_2140 455
155 3300046515 Ga0495620_0003303 Ga0495620_0003303_1700_3091 455
156 3300046518 Ga0495631_0000400 Ga0495631_0000400_14902_16293 455
157 3300046519 Ga0495632_0001045 Ga0495632_0001045_18966_20357 455
158 3300046519 Ga0495632_0014937 Ga0495632_0014937_2432_3823 455
159 3300046520 Ga0495637_0023065 Ga0495637_0023065_425_1816 455
160 3300046530 Ga0495654_0000904 Ga0495654_0000904_14621_16012 455
161 3300046543 Ga0495645_0133698 Ga0495645_0133698_271_1662 455
162 3300046557 Ga0495622_0000129 Ga0495622_0000129_57458_58858 455
163 3300046615 Ga0495656_0000072 Ga0495656_0000072_13932_15326 455
164 3300046616 Ga0495668_0018684 Ga0495668_0018684_1723_3114 455
165 3300046665 Ga0495661_0000580 Ga0495661_0000580_16822_18213 455
166 3300046665 Ga0495661_0015408 Ga0495661_0015408_3078_4469 455
167 3300047320 Ga0495672_0000669 Ga0495672_0000669_25703_27094 455
168 3300047320 Ga0495672_0044938 Ga0495672_0044938_1050_2447 455
169 3300047323 Ga0495683_0000049 Ga0495683_0000049_69290_70684 455
170 3300047469 Ga0495673_0025958 Ga0495673_0025958_561_1952 455
171 3300048905 Ga0496102_0034472 Ga0496102_0034472_357_1748 455
172 3300048908 Ga0496105_0076192 Ga0496105_0076192_1007_2398 455
173 3300048912 Ga0496109_0003646 Ga0496109_0003646_5467_6864 455
174 3300048914 Ga0496111_0108706 Ga0496111_0108706_144_1535 455
175 3300048927 Ga0496124_0000009 Ga0496124_0000009_495136_496599 455
176 3300048928 Ga0496125_0065980 Ga0496125_0065980_1014_2402 455
177 3300049460 Ga0495682_0000185 Ga0495682_0000185_22247_23638 455
178 3300049705 Ga0501225_0000400 Ga0501225_0000400_163_1542 455
179 3300049853 Ga0501226_000032 Ga0501226_000032_17491_18885 455
180 3300053125 Ga0500618_000263 Ga0500618_000263_6103_7503 455
181 3300053125 Ga0500618_000512 Ga0500618_000512_1326_2723 455
182 3300053156 Ga0500622_0029427 Ga0500622_0029427_179_1600 455
183 iso_pu_bacteria 2511231023 2511369217 455
184 iso_pu_bacteria 2808606382 2808961284 455
185 3300001979 JGI24740J21852_10008859 JGI24740J21852_100088592 456
186 3300005327 Ga0070658_10010426 Ga0070658_100104262 456
187 3300025303 Ga0209051_1005254 Ga0209051_10052543 456
188 3300031730 Ga0307516_10000508 Ga0307516_1000050827 456
189 3300044693 Ga0466961_0071961 Ga0466961_0071961_450_1856 456
190 3300046507 Ga0495606_0007519 Ga0495606_0007519_64_1440 456
191 3300053131 Ga0500652_011547 Ga0500652_011547_88_1458 456

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06751

EutB

Ethanolamine ammonia lyase large subunit (EutB)

65

497

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3abo-assembly1.cif.gz_A crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and ethanolamine 0.97 1 444
2qez-assembly4.cif.gz_C crystal structure of ethanolamine ammonia-lyase heavy chain (yp_013784.1) from listeria monocytogenes 4b f2365 at 2.15 a resolution 0.9504 1 446
3abo-assembly1.cif.gz_A crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and ethanolamine 0.9469 1 444
2qez-assembly2.cif.gz_A crystal structure of ethanolamine ammonia-lyase heavy chain (yp_013784.1) from listeria monocytogenes 4b f2365 at 2.15 a resolution 0.9457 1 446
2qez-assembly4.cif.gz_B crystal structure of ethanolamine ammonia-lyase heavy chain (yp_013784.1) from listeria monocytogenes 4b f2365 at 2.15 a resolution 0.9447 1 446
ID Description Score Start End Superfamily
2qezF01 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;ethanolamine ammonia-lyase heavy chain domain like 0.9805 3 51 2.30.170.30
3aboA01 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;ethanolamine ammonia-lyase heavy chain domain like 0.9578 1 54 2.30.170.30
3aboA01 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;ethanolamine ammonia-lyase heavy chain domain like 0.9409 1 54 2.30.170.30
2qezE03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9187 143 446 3.20.20.70
2qezA02 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;lyase 0.9057 56 140 1.10.220.70
ID Description Score Start End GO Terms
AF-A0A210XMX9-F1-model_v4 deleted 0.9963 3 335
AF-A0A3B9L6R8-F1-model_v4 Ethanolamine ammonia lyase large subunit 0.9959 1 140 GO:0005829
GO:0006520
GO:0008851
GO:0009350
GO:0046336
AF-A0A3M2ZGF9-F1-model_v4 Ethanolamine ammonia-lyase, heavy subunit 0.9958 2 158 GO:0005829
GO:0006520
GO:0008851
GO:0009350
GO:0046336
AF-A0A257IUM9-F1-model_v4 Ethanolamine ammonia lyase large subunit 0.9956 83 349 GO:0005829
GO:0006520
GO:0008851
GO:0009350
GO:0046336
AF-A0A3T1DIH3-F1-model_v4 deleted 0.9951 1 140

Feature Viewer

pLDDT pTM Quality
92.81 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map