F294061

General Info

Members Datasets Scaffolds Average Seq Length
191 131 179 300

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10035451|Ga0157372_100354514
Length 345
Sequence MIGRCRLLACDIFGYNKHRFGYTGLFVCVDFCIYKKYNIMNIVLTGSLGHISKPLAQVLIEKGNSITVISSKAERQKDIEALGAKAAIGTMQDLDFLTKTFTGADIVFLMEALGAASFHDPNLDYMAAINKIANSYKQAVQQSGVKRVVHLSSIGAHTDKGNGMLAFHYNVEKILSQLPEDVSIKFMRPVGFYYNMFAFIPTIEKQDAIIQNYSGDKKEPWVSPLDIAAVIAEEMEQPFEGRKIRYIASDEASPDEIAKVLGEAIGKPGLKWQEIPDAQMQNGMVAAGMNPEIAEGLVEMNACRRNDALYEDYYQHKPTLGKVKLTDFAKEFADIYHSKQTNNHN

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
3 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
4 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
8 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
9 2914759650 Rhizosphaericola mali Isolate Rhizosphere
10 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
11 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
12 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 0
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.33
Nodule 0
Rhizoplane 0
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10050578 3300001990 Bacteria 1263
2 rootH1_10064019 3300003316 Bacteria 1178
3 rootH2_10011116 3300003320 Bacteria 111907
4 rootL2_10248342 3300003322 Bacteria 1416
5 rootH1_10060643 3300003323 Bacteria 3419
6 rootH1_10209313 3300003323 Bacteria 1352
7 Ga0055531_10000086 3300003794 Bacteria 101650
8 Ga0065165_1014971 3300005262 Bacteria 2982
9 Ga0070658_10025181 3300005327 Bacteria 4769
10 Ga0070658_10091056 3300005327 Bacteria 2513
11 Ga0070658_10299573 3300005327 Bacteria 1371
12 Ga0070676_10000259 3300005328 Bacteria 23074
13 Ga0070680_100015805 3300005336 Bacteria 5926
14 Ga0070680_100073806 3300005336 Bacteria 2806
15 Ga0068868_100054640 3300005338 Bacteria 3148
16 Ga0070660_100032122 3300005339 Bacteria 3948
17 Ga0070660_100286754 3300005339 Unclassified 1348
18 Ga0070659_100248558 3300005366 Bacteria 1473
19 Ga0070663_100345401 3300005455 Bacteria 1203
20 Ga0070662_100000449 3300005457 Bacteria 24260
21 Ga0070681_10043441 3300005458 Bacteria 4503
22 Ga0070681_10066605 3300005458 Bacteria 3570
23 Ga0070681_10126787 3300005458 Bacteria 2485
24 Ga0070681_10346393 3300005458 Bacteria 1396
25 Ga0070679_100010563 3300005530 Bacteria 8758
26 Ga0070679_100058358 3300005530 Bacteria 3845
27 Ga0070679_100123595 3300005530 Bacteria 2571
28 Ga0070679_100181100 3300005530 Bacteria 2079
29 Ga0070679_100195316 3300005530 Bacteria 1991
30 Ga0068853_100021248 3300005539 Bacteria 5408
31 Ga0068853_100149441 3300005539 Bacteria 2102
32 Ga0070665_100000008 3300005548 Bacteria 606341
33 Ga0070665_100000125 3300005548 Bacteria 146809
34 Ga0068855_100011059 3300005563 Bacteria 10888
35 Ga0068857_100117492 3300005577 Bacteria 2393
36 Ga0068854_100035592 3300005578 Bacteria 3486
37 Ga0068856_100002280 3300005614 Bacteria 19791
38 Ga0068852_100097310 3300005616 Bacteria 2647
39 Ga0068852_100374648 3300005616 Bacteria 1395
40 Ga0068851_10025411 3300005834 Bacteria 2905
41 Ga0068858_100208256 3300005842 Bacteria 1850
42 Ga0068860_100018491 3300005843 Bacteria 6777
43 Ga0075366_10000235 3300006195 Bacteria 24550
44 Ga0097621_100000288 3300006237 Bacteria 33839
45 Ga0097621_100012310 3300006237 Bacteria 6334
46 Ga0068871_100000592 3300006358 Bacteria 24903
47 Ga0068865_100000029 3300006881 Bacteria 91199
48 Ga0105240_10005598 3300009093 Bacteria 18660
49 Ga0105243_10065078 3300009148 Bacteria 2927
50 Ga0105241_10000217 3300009174 Bacteria 43160
51 Ga0105241_10036543 3300009174 Bacteria 3697
52 Ga0105241_10204620 3300009174 Bacteria 1651
53 Ga0105242_10014823 3300009176 Bacteria 6038
54 Ga0105237_10020543 3300009545 Bacteria 6806
55 Ga0105238_10003134 3300009551 Bacteria 16503
56 Ga0105249_10209642 3300009553 Bacteria 1911
57 Ga0105239_10013703 3300010375 Bacteria 9004
58 Ga0105239_10034714 3300010375 Bacteria 5540
59 Ga0105239_10138372 3300010375 Bacteria 2712
60 Ga0105246_10188525 3300011119 Bacteria 1594
61 Ga0157373_10012068 3300013100 Bacteria 6350
62 Ga0157371_10018971 3300013102 Bacteria 5077
63 Ga0157371_10065853 3300013102 Bacteria 2566
64 Ga0157370_10070952 3300013104 Bacteria 3287
65 Ga0157369_10010087 3300013105 Bacteria 10786
66 Ga0157374_10000887 3300013296 Bacteria 26128
67 Ga0157374_10100432 3300013296 Bacteria 2773
68 Ga0157378_10014463 3300013297 Bacteria 6908
69 Ga0157378_10018924 3300013297 Bacteria 6053
70 Ga0163162_10000005 3300013306 Bacteria 447195
71 Ga0163162_10000993 3300013306 Bacteria 26422
72 Ga0157372_10035451 3300013307 Bacteria 5493
73 Ga0157372_10038047 3300013307 Bacteria 5309
74 Ga0157372_10080623 3300013307 Bacteria 3683
75 Ga0157372_10137568 3300013307 Bacteria 2814
76 Ga0157375_10000180 3300013308 Bacteria 59335
77 Ga0157375_10015943 3300013308 Bacteria 6740
78 Ga0157375_10103222 3300013308 Bacteria 2938
79 Ga0157375_10294185 3300013308 Bacteria 1787
80 Ga0157375_10476260 3300013308 Bacteria 1413
81 Ga0157375_10520023 3300013308 Unclassified 1353
82 Ga0157376_10034329 3300014969 Bacteria 4095
83 Ga0157376_10112957 3300014969 Bacteria 2394
84 Ga0182005_1000017 3300015265 Bacteria 331828
85 Ga0213872_10042329 3300021361 Bacteria 2077
86 Ga0209436_104754 3300025208 Bacteria 3281
87 Ga0209026_1000348 3300025250 Bacteria 44090
88 Ga0207426_1002273 3300025302 Bacteria 12682
89 Ga0209257_1000023 3300025304 Bacteria 753019
90 Ga0207656_10029423 3300025321 Bacteria 2262
91 Ga0207642_10033799 3300025899 Bacteria 2167
92 Ga0207647_10000117 3300025904 Bacteria 61849
93 Ga0207645_10001758 3300025907 Bacteria 17574
94 Ga0207705_10012699 3300025909 Bacteria 6077
95 Ga0207705_10045495 3300025909 Bacteria 3154
96 Ga0207705_10233870 3300025909 Bacteria 1398
97 Ga0207654_10002034 3300025911 Bacteria 10375
98 Ga0207654_10009905 3300025911 Unclassified 4846
99 Ga0207654_10088872 3300025911 Bacteria 1878
100 Ga0207707_10086345 3300025912 Bacteria 2742
101 Ga0207695_10005927 3300025913 Bacteria 16016
102 Ga0207695_10016791 3300025913 Bacteria 8547
103 Ga0207671_10073209 3300025914 Bacteria 2559
104 Ga0207660_10017967 3300025917 Bacteria 4709
105 Ga0207657_10012983 3300025919 Bacteria 8187
106 Ga0207657_10191969 3300025919 Bacteria 1647
107 Ga0207657_10206899 3300025919 Unclassified 1576
108 Ga0207652_10000180 3300025921 Bacteria 66974
109 Ga0207652_10010197 3300025921 Bacteria 7563
110 Ga0207690_10204951 3300025932 Bacteria 1500
111 Ga0207706_10000044 3300025933 Bacteria 123576
112 Ga0207686_10063662 3300025934 Bacteria 2346
113 Ga0207709_10060206 3300025935 Bacteria 2366
114 Ga0207704_10000144 3300025938 Bacteria 38148
115 Ga0207691_10058089 3300025940 Bacteria 3519
116 Ga0207667_10005479 3300025949 Bacteria 15471
117 Ga0207667_10081306 3300025949 Bacteria 3356
118 Ga0207667_10103445 3300025949 Unclassified 2937
119 Ga0207651_10020505 3300025960 Bacteria 3991
120 Ga0207651_10065862 3300025960 Unclassified 2543
121 Ga0207712_10015521 3300025961 Bacteria 4916
122 Ga0207639_10024535 3300026041 Bacteria 4365
123 Ga0207639_10067824 3300026041 Bacteria 2777
124 Ga0207639_10103293 3300026041 Bacteria 2309
125 Ga0207678_10225086 3300026067 Bacteria 1606
126 Ga0207648_10024015 3300026089 Bacteria 5449
127 Ga0207676_10579990 3300026095 Bacteria 1075
128 Ga0207674_10044546 3300026116 Bacteria 4570
129 Ga0207683_10012346 3300026121 Bacteria 7288
130 Ga0268266_10000016 3300028379 Bacteria 629101
131 Ga0268266_10000132 3300028379 Bacteria 145563
132 Ga0307515_10000147 3300028794 Bacteria 170482
133 Ga0307515_10102161 3300028794 Bacteria 3452
134 Ga0307515_10198635 3300028794 Bacteria 1889
135 Ga0307511_10000046 3300030521 Bacteria 100284
136 Ga0316183_1079365 3300030742 Bacteria 35752
137 Ga0316181_1065839 3300030744 Bacteria 49342
138 Ga0316182_1219427 3300030745 Bacteria 1908
139 Ga0307509_10048470 3300031507 Bacteria 4562
140 Ga0307509_10298189 3300031507 Bacteria 1362
141 Ga0307514_10060673 3300031649 Bacteria 2884
142 Ga0307412_10000179 3300031911 Bacteria 44961
143 Ga0307510_10001320 3300033180 Bacteria 27047
144 Ga0395900_0000314 3300037418 Bacteria 71758
145 Ga0395900_0014096 3300037418 Bacteria 8161
146 Ga0395898_0028408 3300037466 Bacteria 5604
147 Ga0395898_0378178 3300037466 Bacteria 1351
148 Ga0436361_0292109 3300039447 Bacteria 16952
149 Ga0439445_0000048 3300042004 Bacteria 17050
150 Ga0466959_0081890 3300045049 Bacteria 2326
151 Ga0495627_002044 3300046453 Bacteria 10345
152 Ga0495638_0033930 3300046460 Bacteria 3260
153 Ga0495651_0104813 3300046462 Bacteria 2099
154 Ga0495606_0066641 3300046507 Bacteria 2283
155 Ga0495610_0000006 3300046512 Bacteria 856822
156 Ga0495632_0009874 3300046519 Bacteria 5708
157 Ga0495648_0009166 3300046524 Bacteria 7713
158 Ga0495611_0043233 3300046648 Bacteria 2014
159 Ga0495625_0000663 3300046660 Bacteria 49012
160 Ga0495625_0001290 3300046660 Bacteria 31476
161 Ga0495683_0013945 3300047323 Bacteria 4191
162 Ga0495687_002423 3300047443 Bacteria 15009
163 Ga0495686_0000079 3300047472 Bacteria 202668
164 Ga0495686_0007749 3300047472 Bacteria 8000
165 Ga0495686_0166567 3300047472 Unclassified 1284
166 Ga0496125_0008240 3300048928 Bacteria 10951
167 Ga0501034_0025469 3300049571 Bacteria 6023
168 Ga0501034_0185380 3300049571 Bacteria 2045
169 Ga0501034_0434560 3300049571 Bacteria 1232
170 Ga0501036_0359250 3300049572 Bacteria 1216
171 Ga0501035_0512270 3300049822 Bacteria 986
172 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
173 Ga0500583_0000036 3300053092 Bacteria 95404
174 Ga0500583_0001157 3300053092 Bacteria 7520
175 Ga0500583_0014958 3300053092 Bacteria 3055
176 Ga0500616_0000894 3300053153 Bacteria 32766
177 Ga0500622_0027948 3300053156 Bacteria 2972
178 Ga0500622_0034172 3300053156 Bacteria 2664
179 Ga0500624_000187 3300053157 Bacteria 24423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0512270 Ga0501035_0512270_14_859 273
2 3300005327 Ga0070658_10299573 Ga0070658_102995732 279
3 3300005530 Ga0070679_100058358 Ga0070679_1000583583 279
4 3300025909 Ga0207705_10233870 Ga0207705_102338701 279
5 3300005458 Ga0070681_10346393 Ga0070681_103463932 280
6 3300005539 Ga0068853_100149441 Ga0068853_1001494411 280
7 3300005577 Ga0068857_100117492 Ga0068857_1001174922 280
8 3300005578 Ga0068854_100035592 Ga0068854_1000355924 280
9 3300005614 Ga0068856_100002280 Ga0068856_10000228012 280
10 3300009174 Ga0105241_10204620 Ga0105241_102046202 280
11 3300010375 Ga0105239_10013703 Ga0105239_100137034 280
12 3300013100 Ga0157373_10012068 Ga0157373_100120686 280
13 3300013102 Ga0157371_10065853 Ga0157371_100658531 280
14 3300013105 Ga0157369_10010087 Ga0157369_100100878 280
15 3300013307 Ga0157372_10080623 Ga0157372_100806232 280
16 3300025250 Ga0209026_1000348 Ga0209026_100034831 280
17 3300025911 Ga0207654_10009905 Ga0207654_100099052 280
18 3300025913 Ga0207695_10016791 Ga0207695_100167912 280
19 3300025949 Ga0207667_10081306 Ga0207667_100813064 280
20 3300026041 Ga0207639_10067824 Ga0207639_100678242 280
21 3300046453 Ga0495627_002044 Ga0495627_002044_3781_4683 280
22 3300047472 Ga0495686_0000079 Ga0495686_0000079_197352_198254 280
23 3300053157 Ga0500624_000187 Ga0500624_000187_14485_15381 280
24 3300046462 Ga0495651_0104813 Ga0495651_0104813_651_1550 282
25 3300005339 Ga0070660_100286754 Ga0070660_1002867542 283
26 3300025919 Ga0207657_10206899 Ga0207657_102068992 283
27 3300046512 Ga0495610_0000006 Ga0495610_0000006_709531_710430 283
28 3300031911 Ga0307412_10000179 Ga0307412_1000017933 289
29 3300045049 Ga0466959_0081890 Ga0466959_0081890_1428_2306 290
30 3300013308 Ga0157375_10000180 Ga0157375_1000018036 291
31 3300048928 Ga0496125_0008240 Ga0496125_0008240_6253_7152 291
32 3300005262 Ga0065165_1014971 Ga0065165_10149713 292
33 3300025208 Ga0209436_104754 Ga0209436_1047543 292
34 3300025302 Ga0207426_1002273 Ga0207426_10022737 292
35 iso_pu_bacteria 2511231000 2511232555 292
36 iso_pu_bacteria 2582581281 2585158655 292
37 iso_pu_bacteria 2582581282 2585162942 292
38 iso_pu_bacteria 2818991442 2819575360 292
39 iso_pu_bacteria 2842083920 2842086078 292
40 iso_pu_bacteria 2919437846 2919440485 292
41 iso_pu_bacteria 2946019816 2946022493 292
42 3300005458 Ga0070681_10066605 Ga0070681_100666055 293
43 3300005843 Ga0068860_100018491 Ga0068860_1000184919 293
44 3300013306 Ga0163162_10000993 Ga0163162_100009934 293
45 3300013308 Ga0157375_10520023 Ga0157375_105200232 293
46 iso_pu_bacteria 2585428187 2588233059 293
47 iso_pu_bacteria 2821136567 2821141460 293
48 iso_pu_bacteria 2904467357 2904470935 293
49 iso_pu_bacteria 2914759650 2914760969 293
50 iso_pu_bacteria 2945924605 2945926135 293
51 3300013297 Ga0157378_10018924 Ga0157378_100189242 294
52 3300013308 Ga0157375_10103222 Ga0157375_101032223 294
53 3300028794 Ga0307515_10198635 Ga0307515_101986352 295
54 3300005327 Ga0070658_10091056 Ga0070658_100910562 296
55 3300005328 Ga0070676_10000259 Ga0070676_1000025917 296
56 3300005338 Ga0068868_100054640 Ga0068868_1000546403 296
57 3300005539 Ga0068853_100021248 Ga0068853_1000212484 296
58 3300005548 Ga0070665_100000125 Ga0070665_10000012599 296
59 3300005616 Ga0068852_100374648 Ga0068852_1003746482 296
60 3300005834 Ga0068851_10025411 Ga0068851_100254113 296
61 3300006237 Ga0097621_100000288 Ga0097621_1000002883 296
62 3300006358 Ga0068871_100000592 Ga0068871_1000005923 296
63 3300006881 Ga0068865_100000029 Ga0068865_10000002992 296
64 3300009174 Ga0105241_10036543 Ga0105241_100365433 296
65 3300009176 Ga0105242_10014823 Ga0105242_100148232 296
66 3300009545 Ga0105237_10020543 Ga0105237_100205432 296
67 3300009551 Ga0105238_10003134 Ga0105238_100031348 296
68 3300013104 Ga0157370_10070952 Ga0157370_100709523 296
69 3300013296 Ga0157374_10100432 Ga0157374_101004322 296
70 3300013308 Ga0157375_10294185 Ga0157375_102941851 296
71 3300013308 Ga0157375_10476260 Ga0157375_104762602 296
72 3300014969 Ga0157376_10112957 Ga0157376_101129573 296
73 3300015265 Ga0182005_1000017 Ga0182005_1000017260 296
74 3300025321 Ga0207656_10029423 Ga0207656_100294232 296
75 3300025899 Ga0207642_10033799 Ga0207642_100337992 296
76 3300025907 Ga0207645_10001758 Ga0207645_1000175816 296
77 3300025909 Ga0207705_10045495 Ga0207705_100454954 296
78 3300025911 Ga0207654_10088872 Ga0207654_100888722 296
79 3300025914 Ga0207671_10073209 Ga0207671_100732092 296
80 3300025934 Ga0207686_10063662 Ga0207686_100636622 296
81 3300025938 Ga0207704_10000144 Ga0207704_1000014425 296
82 3300025940 Ga0207691_10058089 Ga0207691_100580892 296
83 3300025960 Ga0207651_10020505 Ga0207651_100205054 296
84 3300025960 Ga0207651_10065862 Ga0207651_100658621 296
85 3300026041 Ga0207639_10024535 Ga0207639_100245353 296
86 3300026089 Ga0207648_10024015 Ga0207648_100240152 296
87 3300026095 Ga0207676_10579990 Ga0207676_105799901 296
88 3300026121 Ga0207683_10012346 Ga0207683_100123467 296
89 3300028379 Ga0268266_10000132 Ga0268266_1000013285 296
90 3300030742 Ga0316183_1079365 Ga0316183_10793653 296
91 3300030744 Ga0316181_1065839 Ga0316181_10658396 296
92 3300030745 Ga0316182_1219427 Ga0316182_12194272 296
93 3300033180 Ga0307510_10001320 Ga0307510_1000132026 296
94 3300042004 Ga0439445_0000048 Ga0439445_0000048_1021_2040 296
95 3300047323 Ga0495683_0013945 Ga0495683_0013945_3155_4048 296
96 3300003316 rootH1_10064019 rootH1_100640191 297
97 3300003322 rootL2_10248342 rootL2_102483422 297
98 3300003794 Ga0055531_10000086 Ga0055531_1000008642 297
99 3300005336 Ga0070680_100015805 Ga0070680_1000158056 297
100 3300005339 Ga0070660_100032122 Ga0070660_1000321223 297
101 3300005366 Ga0070659_100248558 Ga0070659_1002485582 297
102 3300005458 Ga0070681_10126787 Ga0070681_101267872 297
103 3300005530 Ga0070679_100010563 Ga0070679_1000105638 297
104 3300005530 Ga0070679_100181100 Ga0070679_1001811002 297
105 3300005530 Ga0070679_100195316 Ga0070679_1001953162 297
106 3300005616 Ga0068852_100097310 Ga0068852_1000973102 297
107 3300006195 Ga0075366_10000235 Ga0075366_1000023515 297
108 3300006237 Ga0097621_100012310 Ga0097621_1000123108 297
109 3300013102 Ga0157371_10018971 Ga0157371_100189712 297
110 3300013297 Ga0157378_10014463 Ga0157378_100144638 297
111 3300014969 Ga0157376_10034329 Ga0157376_100343292 297
112 3300025304 Ga0209257_1000023 Ga0209257_1000023467 297
113 3300025919 Ga0207657_10012983 Ga0207657_100129835 297
114 3300025919 Ga0207657_10191969 Ga0207657_101919692 297
115 3300025921 Ga0207652_10010197 Ga0207652_100101972 297
116 3300025932 Ga0207690_10204951 Ga0207690_102049512 297
117 3300025949 Ga0207667_10103445 Ga0207667_101034453 297
118 3300026041 Ga0207639_10103293 Ga0207639_101032933 297
119 3300026116 Ga0207674_10044546 Ga0207674_100445462 297
120 3300028794 Ga0307515_10000147 Ga0307515_1000014713 297
121 3300028794 Ga0307515_10102161 Ga0307515_101021612 297
122 3300030521 Ga0307511_10000046 Ga0307511_1000004614 297
123 3300031507 Ga0307509_10048470 Ga0307509_100484703 297
124 3300031507 Ga0307509_10298189 Ga0307509_102981892 297
125 3300031649 Ga0307514_10060673 Ga0307514_100606733 297
126 3300037466 Ga0395898_0378178 Ga0395898_0378178_100_1002 297
127 3300046507 Ga0495606_0066641 Ga0495606_0066641_561_1541 297
128 3300046519 Ga0495632_0009874 Ga0495632_0009874_4734_5636 297
129 3300046660 Ga0495625_0000663 Ga0495625_0000663_28124_29026 297
130 3300046660 Ga0495625_0001290 Ga0495625_0001290_11716_12618 297
131 3300047472 Ga0495686_0007749 Ga0495686_0007749_271_1251 297
132 3300047472 Ga0495686_0166567 Ga0495686_0166567_39_938 297
133 3300049571 Ga0501034_0025469 Ga0501034_0025469_3194_4093 297
134 3300049571 Ga0501034_0185380 Ga0501034_0185380_869_1771 297
135 3300049571 Ga0501034_0434560 Ga0501034_0434560_177_1079 297
136 3300049572 Ga0501036_0359250 Ga0501036_0359250_118_1017 297
137 3300050493 nmdc:mga0k408_31_c1 nmdc:mga0k408_31_c1_74039_74941 297
138 3300053092 Ga0500583_0000036 Ga0500583_0000036_76029_76931 297
139 3300053092 Ga0500583_0014958 Ga0500583_0014958_127_1053 297
140 3300053153 Ga0500616_0000894 Ga0500616_0000894_30085_30990 297
141 3300053156 Ga0500622_0027948 Ga0500622_0027948_1407_2333 297
142 3300001990 JGI24737J22298_10050578 JGI24737J22298_100505782 298
143 3300003320 rootH2_10011116 rootH2_100111166 298
144 3300003323 rootH1_10060643 rootH1_100606432 298
145 3300003323 rootH1_10209313 rootH1_102093132 298
146 3300005327 Ga0070658_10025181 Ga0070658_100251812 298
147 3300005336 Ga0070680_100073806 Ga0070680_1000738063 298
148 3300005455 Ga0070663_100345401 Ga0070663_1003454012 298
149 3300005457 Ga0070662_100000449 Ga0070662_1000004497 298
150 3300005458 Ga0070681_10043441 Ga0070681_100434413 298
151 3300005530 Ga0070679_100123595 Ga0070679_1001235952 298
152 3300005548 Ga0070665_100000008 Ga0070665_100000008178 298
153 3300005563 Ga0068855_100011059 Ga0068855_1000110593 298
154 3300005842 Ga0068858_100208256 Ga0068858_1002082562 298
155 3300009093 Ga0105240_10005598 Ga0105240_100055987 298
156 3300009148 Ga0105243_10065078 Ga0105243_100650783 298
157 3300009174 Ga0105241_10000217 Ga0105241_1000021731 298
158 3300009553 Ga0105249_10209642 Ga0105249_102096422 298
159 3300010375 Ga0105239_10034714 Ga0105239_100347143 298
160 3300010375 Ga0105239_10138372 Ga0105239_101383721 298
161 3300011119 Ga0105246_10188525 Ga0105246_101885252 298
162 3300013296 Ga0157374_10000887 Ga0157374_1000088715 298
163 3300013306 Ga0163162_10000005 Ga0163162_1000000544 298
164 3300013307 Ga0157372_10035451 Ga0157372_100354514 298
165 3300013307 Ga0157372_10038047 Ga0157372_100380476 298
166 3300013307 Ga0157372_10137568 Ga0157372_101375683 298
167 3300013308 Ga0157375_10015943 Ga0157375_100159435 298
168 3300021361 Ga0213872_10042329 Ga0213872_100423292 298
169 3300025904 Ga0207647_10000117 Ga0207647_1000011742 298
170 3300025909 Ga0207705_10012699 Ga0207705_100126996 298
171 3300025911 Ga0207654_10002034 Ga0207654_100020343 298
172 3300025912 Ga0207707_10086345 Ga0207707_100863452 298
173 3300025913 Ga0207695_10005927 Ga0207695_100059277 298
174 3300025917 Ga0207660_10017967 Ga0207660_100179674 298
175 3300025921 Ga0207652_10000180 Ga0207652_1000018018 298
176 3300025933 Ga0207706_10000044 Ga0207706_100000447 298
177 3300025935 Ga0207709_10060206 Ga0207709_100602063 298
178 3300025949 Ga0207667_10005479 Ga0207667_1000547917 298
179 3300025961 Ga0207712_10015521 Ga0207712_100155216 298
180 3300026067 Ga0207678_10225086 Ga0207678_102250861 298
181 3300028379 Ga0268266_10000016 Ga0268266_10000016176 298
182 3300037418 Ga0395900_0000314 Ga0395900_0000314_23017_23919 298
183 3300037418 Ga0395900_0014096 Ga0395900_0014096_2876_3913 298
184 3300037466 Ga0395898_0028408 Ga0395898_0028408_2709_3746 298
185 3300039447 Ga0436361_0292109 Ga0436361_0292109_8266_9204 298
186 3300046460 Ga0495638_0033930 Ga0495638_0033930_1689_2600 298
187 3300046524 Ga0495648_0009166 Ga0495648_0009166_41_952 298
188 3300046648 Ga0495611_0043233 Ga0495611_0043233_1037_1948 298
189 3300047443 Ga0495687_002423 Ga0495687_002423_11105_12001 298
190 3300053092 Ga0500583_0001157 Ga0500583_0001157_2150_3061 298
191 3300053156 Ga0500622_0034172 Ga0500622_0034172_741_1652 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

42

170

0.84

PF05368

NmrA

NmrA-like family

42

315

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

46

238

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9019 2 34
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9018 2 34
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9013 2 34
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9012 1 34
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.8993 1 34
ID Description Score Start End Superfamily
3dmeB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9241 1 30 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9013 2 34 3.50.50.60
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8957 2 40 3.90.180.10
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8935 3 30 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8793 2 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A316AQ84-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.9884 1 295
AF-A0A2K8Z9P1-F1-model_v4 NAD-dependent dehydratase 0.9837 1 293
AF-A0A4Q3HH83-F1-model_v4 deleted 0.9828 1 296
AF-A0A519JT24-F1-model_v4 NAD-dependent dehydratase 0.9809 54 293
AF-A0A316AQ84-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.9785 1 295

Feature Viewer

pLDDT pTM Quality
95.06 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map