F293834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 191 | 100 | 382 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_100026716|Ga0097621_1000267164 |
| Length | 409 |
| Sequence | MGLGHKSHYGQTPGSCSQENLLYLARMTLAEILSNEELRRHEFPVAARQIFLGHAGDCPVPRRVSDAICAYARQSSEGDQERAIYPAIIEKGRKLGAELMNCQPGEVALVGPTSLALSLIASGLKFRRGENILIYFDDYPSNVYPWMAMAEQRVEVRMLNIRNLGIIRAKDVLGQVDENTRMVALASCHFISGFRIDHEEIGKALRERNILFCLDAIQTLGAFRTTVEHVDMLAADAHKWLLGPCGAGLMYVRQELQPNLTPPIYGWNNVRCPNYVALEEIIFRTGAQKYEAGTHNLLGIVGLVAAMELVLEIGVDNITRELLRKRAWLSSQLTAKGYTVLNAQPDDANGSGITSFFKPDTDLTALHQKLLDAGIFTSLRTDRKGQKYIRLSPHFYNTDAELARVMEHI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 9 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 10 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 11 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 12 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 13 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 14 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 15 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 16 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 36 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 37 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 38 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 39 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 40 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 41 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 42 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 43 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 44 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 45 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 46 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 47 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 48 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 49 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 50 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 51 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 52 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 53 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 54 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 55 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 56 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 57 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 58 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 59 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 60 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 61 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 62 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 63 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 64 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 65 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 66 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 67 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 68 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 69 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 70 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 71 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 89 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 90 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 91 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 92 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 93 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 94 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 98 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.52 |
| Rhizosphere | 98.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0097621_100026716 | 3300006237 | Bacteria | 4532 |
| 2 | rootH2_10113708 | 3300003320 | Bacteria | 6867 |
| 3 | Ga0070689_100289393 | 3300005340 | Unclassified | 1361 |
| 4 | Ga0070714_100004992 | 3300005435 | Bacteria | 10086 |
| 5 | Ga0070711_100007821 | 3300005439 | Bacteria | 6514 |
| 6 | Ga0070681_10016810 | 3300005458 | Bacteria | 7306 |
| 7 | Ga0070679_100418660 | 3300005530 | Unclassified | 1285 |
| 8 | Ga0068855_100030781 | 3300005563 | Bacteria | 6416 |
| 9 | Ga0068855_100160402 | 3300005563 | Bacteria | 2553 |
| 10 | Ga0068857_100063839 | 3300005577 | Bacteria | 3274 |
| 11 | Ga0068856_100000211 | 3300005614 | Bacteria | 63015 |
| 12 | Ga0068856_100174873 | 3300005614 | Bacteria | 2159 |
| 13 | Ga0068859_100103573 | 3300005617 | Bacteria | 2904 |
| 14 | Ga0068864_100060361 | 3300005618 | Bacteria | 3283 |
| 15 | Ga0068863_100087102 | 3300005841 | Bacteria | 2959 |
| 16 | Ga0068871_100036756 | 3300006358 | Bacteria | 3900 |
| 17 | Ga0075428_100002140 | 3300006844 | Bacteria | 21316 |
| 18 | Ga0097620_100103575 | 3300006931 | Bacteria | 2904 |
| 19 | Ga0105240_10008598 | 3300009093 | Bacteria | 14592 |
| 20 | Ga0105240_10155921 | 3300009093 | Unclassified | 2716 |
| 21 | Ga0111539_10198544 | 3300009094 | Bacteria | 2340 |
| 22 | Ga0105242_10041884 | 3300009176 | Bacteria | 3695 |
| 23 | Ga0105238_10013238 | 3300009551 | Bacteria | 8323 |
| 24 | Ga0105238_10068067 | 3300009551 | Bacteria | 3561 |
| 25 | Ga0157370_10020143 | 3300013104 | Bacteria | 6667 |
| 26 | Ga0157372_10298747 | 3300013307 | Unclassified | 1873 |
| 27 | Ga0157375_10000072 | 3300013308 | Bacteria | 106823 |
| 28 | Ga0163163_10002586 | 3300014325 | Bacteria | 15329 |
| 29 | Ga0157376_10129943 | 3300014969 | Unclassified | 2246 |
| 30 | Ga0207695_10055988 | 3300025913 | Bacteria | 4106 |
| 31 | Ga0207695_10072670 | 3300025913 | Unclassified | 3508 |
| 32 | Ga0207652_10078946 | 3300025921 | Bacteria | 2875 |
| 33 | Ga0207652_10361707 | 3300025921 | Unclassified | 1310 |
| 34 | Ga0207694_10005970 | 3300025924 | Bacteria | 9332 |
| 35 | Ga0207694_10048912 | 3300025924 | Bacteria | 3272 |
| 36 | Ga0207694_10084908 | 3300025924 | Unclassified | 2491 |
| 37 | Ga0207670_10247940 | 3300025936 | Unclassified | 1375 |
| 38 | Ga0207667_10005560 | 3300025949 | Bacteria | 15380 |
| 39 | Ga0207667_10127716 | 3300025949 | Bacteria | 2619 |
| 40 | Ga0207667_10298520 | 3300025949 | Bacteria | 1646 |
| 41 | Ga0207702_10001647 | 3300026078 | Bacteria | 22041 |
| 42 | Ga0207641_10020865 | 3300026088 | Bacteria | 5385 |
| 43 | Ga0207641_10029851 | 3300026088 | Bacteria | 4510 |
| 44 | Ga0207641_10329031 | 3300026088 | Unclassified | 1451 |
| 45 | Ga0207676_10087971 | 3300026095 | Bacteria | 2542 |
| 46 | Ga0207674_10012719 | 3300026116 | Bacteria | 9405 |
| 47 | Ga0265337_1000018 | 3300028556 | Bacteria | 76481 |
| 48 | Ga0265337_1000622 | 3300028556 | Bacteria | 18726 |
| 49 | Ga0265337_1003845 | 3300028556 | Bacteria | 6380 |
| 50 | Ga0265337_1018457 | 3300028556 | Bacteria | 2215 |
| 51 | Ga0265337_1020636 | 3300028556 | Bacteria | 2063 |
| 52 | Ga0265337_1030093 | 3300028556 | Bacteria | 1619 |
| 53 | Ga0265326_10009472 | 3300028558 | Bacteria | 2913 |
| 54 | Ga0265319_1000001 | 3300028563 | Bacteria | 549513 |
| 55 | Ga0265319_1002660 | 3300028563 | Bacteria | 9595 |
| 56 | Ga0265319_1021655 | 3300028563 | Bacteria | 2356 |
| 57 | Ga0265319_1028693 | 3300028563 | Unclassified | 1959 |
| 58 | Ga0265334_10005317 | 3300028573 | Bacteria | 5627 |
| 59 | Ga0265334_10036066 | 3300028573 | Bacteria | 1954 |
| 60 | Ga0265334_10038687 | 3300028573 | Bacteria | 1875 |
| 61 | Ga0265323_10028924 | 3300028653 | Bacteria | 2076 |
| 62 | Ga0265336_10000383 | 3300028666 | Bacteria | 28214 |
| 63 | Ga0265336_10014974 | 3300028666 | Bacteria | 2560 |
| 64 | Ga0265336_10018896 | 3300028666 | Unclassified | 2228 |
| 65 | Ga0265336_10044608 | 3300028666 | Bacteria | 1349 |
| 66 | Ga0265338_10000032 | 3300028800 | Bacteria | 257580 |
| 67 | Ga0265338_10000050 | 3300028800 | Bacteria | 213659 |
| 68 | Ga0265338_10000440 | 3300028800 | Bacteria | 74544 |
| 69 | Ga0265338_10001071 | 3300028800 | Bacteria | 45427 |
| 70 | Ga0265338_10001288 | 3300028800 | Bacteria | 41141 |
| 71 | Ga0265338_10001464 | 3300028800 | Bacteria | 38231 |
| 72 | Ga0265338_10001684 | 3300028800 | Bacteria | 35127 |
| 73 | Ga0265338_10001911 | 3300028800 | Bacteria | 32527 |
| 74 | Ga0265338_10004730 | 3300028800 | Bacteria | 18212 |
| 75 | Ga0265338_10006353 | 3300028800 | Bacteria | 15097 |
| 76 | Ga0265338_10006473 | 3300028800 | Bacteria | 14919 |
| 77 | Ga0265338_10007150 | 3300028800 | Bacteria | 13976 |
| 78 | Ga0265338_10025253 | 3300028800 | Bacteria | 6037 |
| 79 | Ga0265338_10030462 | 3300028800 | Bacteria | 5315 |
| 80 | Ga0265338_10031867 | 3300028800 | Bacteria | 5158 |
| 81 | Ga0265338_10033190 | 3300028800 | Bacteria | 5015 |
| 82 | Ga0265338_10045549 | 3300028800 | Bacteria | 4031 |
| 83 | Ga0265338_10069632 | 3300028800 | Bacteria | 3021 |
| 84 | Ga0265338_10075655 | 3300028800 | Bacteria | 2856 |
| 85 | Ga0265324_10000586 | 3300029957 | Bacteria | 24901 |
| 86 | Ga0265324_10000892 | 3300029957 | Bacteria | 18980 |
| 87 | Ga0265324_10017920 | 3300029957 | Bacteria | 2571 |
| 88 | Ga0265324_10026147 | 3300029957 | Bacteria | 2067 |
| 89 | Ga0265332_10018265 | 3300031238 | Bacteria | 3094 |
| 90 | Ga0265320_10000480 | 3300031240 | Bacteria | 31225 |
| 91 | Ga0265320_10001279 | 3300031240 | Bacteria | 18377 |
| 92 | Ga0265340_10003058 | 3300031247 | Bacteria | 9509 |
| 93 | Ga0265340_10011986 | 3300031247 | Unclassified | 4586 |
| 94 | Ga0265339_10002866 | 3300031249 | Bacteria | 12212 |
| 95 | Ga0265339_10027918 | 3300031249 | Bacteria | 3214 |
| 96 | Ga0265339_10048791 | 3300031249 | Bacteria | 2321 |
| 97 | Ga0265327_10000769 | 3300031251 | Bacteria | 49436 |
| 98 | Ga0265327_10050324 | 3300031251 | Unclassified | 2180 |
| 99 | Ga0265327_10087496 | 3300031251 | Bacteria | 1526 |
| 100 | Ga0265316_10012966 | 3300031344 | Bacteria | 7437 |
| 101 | Ga0265316_10015026 | 3300031344 | Bacteria | 6787 |
| 102 | Ga0265316_10034466 | 3300031344 | Bacteria | 4112 |
| 103 | Ga0265316_10043222 | 3300031344 | Bacteria | 3594 |
| 104 | Ga0265316_10067128 | 3300031344 | Bacteria | 2774 |
| 105 | Ga0265316_10089406 | 3300031344 | Bacteria | 2350 |
| 106 | Ga0265316_10097564 | 3300031344 | Unclassified | 2237 |
| 107 | Ga0265313_10002628 | 3300031595 | Bacteria | 15283 |
| 108 | Ga0265313_10011593 | 3300031595 | Bacteria | 5467 |
| 109 | Ga0265314_10000469 | 3300031711 | Bacteria | 53607 |
| 110 | Ga0265342_10045760 | 3300031712 | Bacteria | 2632 |
| 111 | Ga0373928_0000052 | 3300035084 | Bacteria | 20328 |
| 112 | Ga0373929_0003177 | 3300035085 | Bacteria | 2977 |
| 113 | Ga0373944_0000506 | 3300035089 | Bacteria | 9075 |
| 114 | Ga0373951_0001225 | 3300035091 | Bacteria | 6788 |
| 115 | Ga0373923_0076476 | 3300035111 | Bacteria | 1446 |
| 116 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 117 | Ga0373954_0007029 | 3300035118 | Bacteria | 4909 |
| 118 | Ga0373956_0010099 | 3300035119 | Bacteria | 3856 |
| 119 | Ga0373962_0000058 | 3300035242 | Bacteria | 23873 |
| 120 | Ga0373931_0000008 | 3300035691 | Bacteria | 362269 |
| 121 | Ga0373931_0083036 | 3300035691 | Bacteria | 1772 |
| 122 | Ga0373935_0001224 | 3300035692 | Bacteria | 14180 |
| 123 | Ga0373935_0088369 | 3300035692 | Bacteria | 2025 |
| 124 | Ga0373927_0023169 | 3300035695 | Bacteria | 4067 |
| 125 | Ga0373927_0028149 | 3300035695 | Bacteria | 3667 |
| 126 | Ga0373927_0033183 | 3300035695 | Bacteria | 3361 |
| 127 | Ga0373933_0011147 | 3300035724 | Bacteria | 4945 |
| 128 | Ga0373947_0028517 | 3300035725 | Bacteria | 3274 |
| 129 | Ga0373937_0043674 | 3300036401 | Bacteria | 4093 |
| 130 | Ga0373937_0062084 | 3300036401 | Bacteria | 3435 |
| 131 | Ga0373937_0150781 | 3300036401 | Unclassified | 2178 |
| 132 | Ga0373937_0180191 | 3300036401 | Bacteria | 1984 |
| 133 | Ga0373925_0000513 | 3300037068 | Bacteria | 39022 |
| 134 | Ga0373925_0013138 | 3300037068 | Bacteria | 5993 |
| 135 | Ga0373925_0018448 | 3300037068 | Bacteria | 5071 |
| 136 | Ga0451577_0020858 | 3300042876 | Bacteria | 6006 |
| 137 | Ga0451577_0044686 | 3300042876 | Bacteria | 3966 |
| 138 | Ga0453684_0004390 | 3300044712 | Bacteria | 29850 |
| 139 | Ga0453684_0016297 | 3300044712 | Bacteria | 11637 |
| 140 | Ga0453684_0034986 | 3300044712 | Bacteria | 6955 |
| 141 | Ga0451576_0156198 | 3300045051 | Bacteria | 2380 |
| 142 | Ga0451576_0207076 | 3300045051 | Bacteria | 2048 |
| 143 | Ga0451576_0268869 | 3300045051 | Unclassified | 1782 |
| 144 | Ga0451576_0298802 | 3300045051 | Bacteria | 1684 |
| 145 | Ga0451576_0305061 | 3300045051 | Bacteria | 1665 |
| 146 | Ga0495592_0000464 | 3300046454 | Bacteria | 30065 |
| 147 | Ga0495592_0011331 | 3300046454 | Bacteria | 6744 |
| 148 | Ga0495628_0000259 | 3300046516 | Bacteria | 47040 |
| 149 | Ga0495630_0000063 | 3300046517 | Bacteria | 85919 |
| 150 | Ga0495630_0058684 | 3300046517 | Bacteria | 2885 |
| 151 | Ga0495652_0137245 | 3300046529 | Bacteria | 1928 |
| 152 | Ga0495652_0226141 | 3300046529 | Bacteria | 1402 |
| 153 | Ga0495640_0039703 | 3300046533 | Bacteria | 3301 |
| 154 | Ga0495640_0075099 | 3300046533 | Bacteria | 2258 |
| 155 | Ga0495586_0000009 | 3300046535 | Bacteria | 144639 |
| 156 | Ga0495586_0001197 | 3300046535 | Bacteria | 14571 |
| 157 | Ga0495586_0004098 | 3300046535 | Bacteria | 7808 |
| 158 | Ga0495586_0019955 | 3300046535 | Bacteria | 3570 |
| 159 | Ga0495645_0025518 | 3300046543 | Bacteria | 4290 |
| 160 | Ga0495645_0057867 | 3300046543 | Bacteria | 2813 |
| 161 | Ga0495667_0028007 | 3300046559 | Bacteria | 3794 |
| 162 | Ga0495634_0013238 | 3300046642 | Bacteria | 5964 |
| 163 | Ga0495634_0017447 | 3300046642 | Bacteria | 5121 |
| 164 | Ga0495634_0060368 | 3300046642 | Unclassified | 2523 |
| 165 | Ga0495599_0071029 | 3300046678 | Bacteria | 2173 |
| 166 | Ga0495658_0139544 | 3300046683 | Bacteria | 1481 |
| 167 | Ga0495613_0016462 | 3300046689 | Bacteria | 5506 |
| 168 | Ga0495581_0166388 | 3300047315 | Bacteria | 1289 |
| 169 | Ga0495674_0000451 | 3300047319 | Bacteria | 37104 |
| 170 | Ga0495676_0004825 | 3300047321 | Bacteria | 12365 |
| 171 | Ga0495680_0009594 | 3300047322 | Bacteria | 8694 |
| 172 | Ga0495684_0066360 | 3300047471 | Bacteria | 2744 |
| 173 | Ga0496115_0050730 | 3300048918 | Bacteria | 3325 |
| 174 | Ga0501031_0000310 | 3300049568 | Bacteria | 27898 |
| 175 | Ga0501032_0016794 | 3300049569 | Bacteria | 5143 |
| 176 | Ga0501033_0011340 | 3300049570 | Bacteria | 6821 |
| 177 | Ga0501033_0016534 | 3300049570 | Bacteria | 5584 |
| 178 | Ga0501033_0038382 | 3300049570 | Bacteria | 3581 |
| 179 | Ga0501036_0085694 | 3300049572 | Unclassified | 2663 |
| 180 | Ga0501036_0363979 | 3300049572 | Unclassified | 1207 |
| 181 | Ga0501037_0190674 | 3300049573 | Unclassified | 1451 |
| 182 | Ga0501043_0060540 | 3300049579 | Unclassified | 2972 |
| 183 | Ga0501035_0015673 | 3300049822 | Bacteria | 6996 |
| 184 | Ga0501035_0055705 | 3300049822 | Unclassified | 3529 |
| 185 | Ga0501035_0287784 | 3300049822 | Bacteria | 1387 |
| 186 | Ga0501044_0000014 | 3300049823 | Bacteria | 244619 |
| 187 | Ga0501044_0009191 | 3300049823 | Bacteria | 10795 |
| 188 | nmdc:mga06r32_61830_c1 | 3300050510 | Bacteria | 3606 |
| 189 | nmdc:mga08y16_185066_c1 | 3300050511 | Bacteria | 2162 |
| 190 | nmdc:mga0n895_211095_c1 | 3300050512 | Unclassified | 1971 |
| 191 | Ga0495601_0187323 | 3300053077 | Bacteria | 1353 |
| 192 | Ga0097621_100026716 | |||
| 193 | rootH2_10113708 | |||
| 194 | Ga0070689_100289393 | |||
| 195 | Ga0070714_100004992 | |||
| 196 | Ga0070711_100007821 | |||
| 197 | Ga0070681_10016810 | |||
| 198 | Ga0070679_100418660 | |||
| 199 | Ga0068855_100030781 | |||
| 200 | Ga0068855_100160402 | |||
| 201 | Ga0068857_100063839 | |||
| 202 | Ga0068856_100000211 | |||
| 203 | Ga0068856_100174873 | |||
| 204 | Ga0068859_100103573 | |||
| 205 | Ga0068864_100060361 | |||
| 206 | Ga0068863_100087102 | |||
| 207 | Ga0068871_100036756 | |||
| 208 | Ga0075428_100002140 | |||
| 209 | Ga0097620_100103575 | |||
| 210 | Ga0105240_10008598 | |||
| 211 | Ga0105240_10155921 | |||
| 212 | Ga0111539_10198544 | |||
| 213 | Ga0105242_10041884 | |||
| 214 | Ga0105238_10013238 | |||
| 215 | Ga0105238_10068067 | |||
| 216 | Ga0157370_10020143 | |||
| 217 | Ga0157372_10298747 | |||
| 218 | Ga0157375_10000072 | |||
| 219 | Ga0163163_10002586 | |||
| 220 | Ga0157376_10129943 | |||
| 221 | Ga0207695_10055988 | |||
| 222 | Ga0207695_10072670 | |||
| 223 | Ga0207652_10078946 | |||
| 224 | Ga0207652_10361707 | |||
| 225 | Ga0207694_10005970 | |||
| 226 | Ga0207694_10048912 | |||
| 227 | Ga0207694_10084908 | |||
| 228 | Ga0207670_10247940 | |||
| 229 | Ga0207667_10005560 | |||
| 230 | Ga0207667_10127716 | |||
| 231 | Ga0207667_10298520 | |||
| 232 | Ga0207702_10001647 | |||
| 233 | Ga0207641_10020865 | |||
| 234 | Ga0207641_10029851 | |||
| 235 | Ga0207641_10329031 | |||
| 236 | Ga0207676_10087971 | |||
| 237 | Ga0207674_10012719 | |||
| 238 | Ga0265337_1000018 | |||
| 239 | Ga0265337_1000622 | |||
| 240 | Ga0265337_1003845 | |||
| 241 | Ga0265337_1018457 | |||
| 242 | Ga0265337_1020636 | |||
| 243 | Ga0265337_1030093 | |||
| 244 | Ga0265326_10009472 | |||
| 245 | Ga0265319_1000001 | |||
| 246 | Ga0265319_1002660 | |||
| 247 | Ga0265319_1021655 | |||
| 248 | Ga0265319_1028693 | |||
| 249 | Ga0265334_10005317 | |||
| 250 | Ga0265334_10036066 | |||
| 251 | Ga0265334_10038687 | |||
| 252 | Ga0265323_10028924 | |||
| 253 | Ga0265336_10000383 | |||
| 254 | Ga0265336_10014974 | |||
| 255 | Ga0265336_10018896 | |||
| 256 | Ga0265336_10044608 | |||
| 257 | Ga0265338_10000032 | |||
| 258 | Ga0265338_10000050 | |||
| 259 | Ga0265338_10000440 | |||
| 260 | Ga0265338_10001071 | |||
| 261 | Ga0265338_10001288 | |||
| 262 | Ga0265338_10001464 | |||
| 263 | Ga0265338_10001684 | |||
| 264 | Ga0265338_10001911 | |||
| 265 | Ga0265338_10004730 | |||
| 266 | Ga0265338_10006353 | |||
| 267 | Ga0265338_10006473 | |||
| 268 | Ga0265338_10007150 | |||
| 269 | Ga0265338_10025253 | |||
| 270 | Ga0265338_10030462 | |||
| 271 | Ga0265338_10031867 | |||
| 272 | Ga0265338_10033190 | |||
| 273 | Ga0265338_10045549 | |||
| 274 | Ga0265338_10069632 | |||
| 275 | Ga0265338_10075655 | |||
| 276 | Ga0265324_10000586 | |||
| 277 | Ga0265324_10000892 | |||
| 278 | Ga0265324_10017920 | |||
| 279 | Ga0265324_10026147 | |||
| 280 | Ga0265332_10018265 | |||
| 281 | Ga0265320_10000480 | |||
| 282 | Ga0265320_10001279 | |||
| 283 | Ga0265340_10003058 | |||
| 284 | Ga0265340_10011986 | |||
| 285 | Ga0265339_10002866 | |||
| 286 | Ga0265339_10027918 | |||
| 287 | Ga0265339_10048791 | |||
| 288 | Ga0265327_10000769 | |||
| 289 | Ga0265327_10050324 | |||
| 290 | Ga0265327_10087496 | |||
| 291 | Ga0265316_10012966 | |||
| 292 | Ga0265316_10015026 | |||
| 293 | Ga0265316_10034466 | |||
| 294 | Ga0265316_10043222 | |||
| 295 | Ga0265316_10067128 | |||
| 296 | Ga0265316_10089406 | |||
| 297 | Ga0265316_10097564 | |||
| 298 | Ga0265313_10002628 | |||
| 299 | Ga0265313_10011593 | |||
| 300 | Ga0265314_10000469 | |||
| 301 | Ga0265342_10045760 | |||
| 302 | Ga0373928_0000052 | |||
| 303 | Ga0373929_0003177 | |||
| 304 | Ga0373944_0000506 | |||
| 305 | Ga0373951_0001225 | |||
| 306 | Ga0373923_0076476 | |||
| 307 | Ga0373932_0000001 | |||
| 308 | Ga0373954_0007029 | |||
| 309 | Ga0373956_0010099 | |||
| 310 | Ga0373962_0000058 | |||
| 311 | Ga0373931_0000008 | |||
| 312 | Ga0373931_0083036 | |||
| 313 | Ga0373935_0001224 | |||
| 314 | Ga0373935_0088369 | |||
| 315 | Ga0373927_0023169 | |||
| 316 | Ga0373927_0028149 | |||
| 317 | Ga0373927_0033183 | |||
| 318 | Ga0373933_0011147 | |||
| 319 | Ga0373947_0028517 | |||
| 320 | Ga0373937_0043674 | |||
| 321 | Ga0373937_0062084 | |||
| 322 | Ga0373937_0150781 | |||
| 323 | Ga0373937_0180191 | |||
| 324 | Ga0373925_0000513 | |||
| 325 | Ga0373925_0013138 | |||
| 326 | Ga0373925_0018448 | |||
| 327 | Ga0451577_0020858 | |||
| 328 | Ga0451577_0044686 | |||
| 329 | Ga0453684_0004390 | |||
| 330 | Ga0453684_0016297 | |||
| 331 | Ga0453684_0034986 | |||
| 332 | Ga0451576_0156198 | |||
| 333 | Ga0451576_0207076 | |||
| 334 | Ga0451576_0268869 | |||
| 335 | Ga0451576_0298802 | |||
| 336 | Ga0451576_0305061 | |||
| 337 | Ga0495592_0000464 | |||
| 338 | Ga0495592_0011331 | |||
| 339 | Ga0495628_0000259 | |||
| 340 | Ga0495630_0000063 | |||
| 341 | Ga0495630_0058684 | |||
| 342 | Ga0495652_0137245 | |||
| 343 | Ga0495652_0226141 | |||
| 344 | Ga0495640_0039703 | |||
| 345 | Ga0495640_0075099 | |||
| 346 | Ga0495586_0000009 | |||
| 347 | Ga0495586_0001197 | |||
| 348 | Ga0495586_0004098 | |||
| 349 | Ga0495586_0019955 | |||
| 350 | Ga0495645_0025518 | |||
| 351 | Ga0495645_0057867 | |||
| 352 | Ga0495667_0028007 | |||
| 353 | Ga0495634_0013238 | |||
| 354 | Ga0495634_0017447 | |||
| 355 | Ga0495634_0060368 | |||
| 356 | Ga0495599_0071029 | |||
| 357 | Ga0495658_0139544 | |||
| 358 | Ga0495613_0016462 | |||
| 359 | Ga0495581_0166388 | |||
| 360 | Ga0495674_0000451 | |||
| 361 | Ga0495676_0004825 | |||
| 362 | Ga0495680_0009594 | |||
| 363 | Ga0495684_0066360 | |||
| 364 | Ga0496115_0050730 | |||
| 365 | Ga0501031_0000310 | |||
| 366 | Ga0501032_0016794 | |||
| 367 | Ga0501033_0011340 | |||
| 368 | Ga0501033_0016534 | |||
| 369 | Ga0501033_0038382 | |||
| 370 | Ga0501036_0085694 | |||
| 371 | Ga0501036_0363979 | |||
| 372 | Ga0501037_0190674 | |||
| 373 | Ga0501043_0060540 | |||
| 374 | Ga0501035_0015673 | |||
| 375 | Ga0501035_0055705 | |||
| 376 | Ga0501035_0287784 | |||
| 377 | Ga0501044_0000014 | |||
| 378 | Ga0501044_0009191 | |||
| 379 | nmdc:mga06r32_61830_c1 | |||
| 380 | nmdc:mga08y16_185066_c1 | |||
| 381 | nmdc:mga0n895_211095_c1 | |||
| 382 | Ga0495601_0187323 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b87-assembly1.cif.gz_A | crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution | 0.9104 | 11 | 381 |
| 5b7s-assembly1.cif.gz_A | apo structure of cysteine desulfurase from thermococcus onnurineus na1 | 0.9039 | 10 | 381 |
| 6c9e-assembly1.cif.gz_A | crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1 | 0.8993 | 10 | 381 |
| 1elu-assembly1.cif.gz_B | complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. | 0.898 | 17 | 380 |
| 6wci-assembly1.cif.gz_A | crystal structure of a cysteine desulfurase sufs from stenotrophomonas maltophilia k279a | 0.8975 | 7 | 381 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10089_37_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9054 | 38 | 279 | 3.40.640.10 |
| 1elqB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8846 | 38 | 285 | 3.40.640.10 |
| af_Q0INV6_1_200_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8776 | 82 | 276 | 3.40.640.10 |
| af_A0A368UH16_90_350_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.872 | 35 | 286 | 3.40.640.10 |
| af_Q10089_37_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.868 | 38 | 279 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0DTZ7-F1-model_v4 | Aminotransferase | 0.9769 | 1 | 382 |
GO:0008483
|
| AF-A0A3C0DTZ7-F1-model_v4 | Aminotransferase | 0.9744 | 1 | 382 |
GO:0008483
|
| AF-A0A7C8DHS0-F1-model_v4 | deleted | 0.9722 | 2 | 237 |
|
| AF-A0A2D6V5W1-F1-model_v4 | deleted | 0.9394 | 17 | 382 |
|
| AF-A0A524LP53-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9393 | 1 | 381 |
GO:0008483
|