F293834

General Info

Members Datasets Scaffolds Average Seq Length
191 100 382 382

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100026716|Ga0097621_1000267164
Length 409
Sequence MGLGHKSHYGQTPGSCSQENLLYLARMTLAEILSNEELRRHEFPVAARQIFLGHAGDCPVPRRVSDAICAYARQSSEGDQERAIYPAIIEKGRKLGAELMNCQPGEVALVGPTSLALSLIASGLKFRRGENILIYFDDYPSNVYPWMAMAEQRVEVRMLNIRNLGIIRAKDVLGQVDENTRMVALASCHFISGFRIDHEEIGKALRERNILFCLDAIQTLGAFRTTVEHVDMLAADAHKWLLGPCGAGLMYVRQELQPNLTPPIYGWNNVRCPNYVALEEIIFRTGAQKYEAGTHNLLGIVGLVAAMELVLEIGVDNITRELLRKRAWLSSQLTAKGYTVLNAQPDDANGSGITSFFKPDTDLTALHQKLLDAGIFTSLRTDRKGQKYIRLSPHFYNTDAELARVMEHI

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
36 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
37 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
38 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
53 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100026716 3300006237 Bacteria 4532
2 rootH2_10113708 3300003320 Bacteria 6867
3 Ga0070689_100289393 3300005340 Unclassified 1361
4 Ga0070714_100004992 3300005435 Bacteria 10086
5 Ga0070711_100007821 3300005439 Bacteria 6514
6 Ga0070681_10016810 3300005458 Bacteria 7306
7 Ga0070679_100418660 3300005530 Unclassified 1285
8 Ga0068855_100030781 3300005563 Bacteria 6416
9 Ga0068855_100160402 3300005563 Bacteria 2553
10 Ga0068857_100063839 3300005577 Bacteria 3274
11 Ga0068856_100000211 3300005614 Bacteria 63015
12 Ga0068856_100174873 3300005614 Bacteria 2159
13 Ga0068859_100103573 3300005617 Bacteria 2904
14 Ga0068864_100060361 3300005618 Bacteria 3283
15 Ga0068863_100087102 3300005841 Bacteria 2959
16 Ga0068871_100036756 3300006358 Bacteria 3900
17 Ga0075428_100002140 3300006844 Bacteria 21316
18 Ga0097620_100103575 3300006931 Bacteria 2904
19 Ga0105240_10008598 3300009093 Bacteria 14592
20 Ga0105240_10155921 3300009093 Unclassified 2716
21 Ga0111539_10198544 3300009094 Bacteria 2340
22 Ga0105242_10041884 3300009176 Bacteria 3695
23 Ga0105238_10013238 3300009551 Bacteria 8323
24 Ga0105238_10068067 3300009551 Bacteria 3561
25 Ga0157370_10020143 3300013104 Bacteria 6667
26 Ga0157372_10298747 3300013307 Unclassified 1873
27 Ga0157375_10000072 3300013308 Bacteria 106823
28 Ga0163163_10002586 3300014325 Bacteria 15329
29 Ga0157376_10129943 3300014969 Unclassified 2246
30 Ga0207695_10055988 3300025913 Bacteria 4106
31 Ga0207695_10072670 3300025913 Unclassified 3508
32 Ga0207652_10078946 3300025921 Bacteria 2875
33 Ga0207652_10361707 3300025921 Unclassified 1310
34 Ga0207694_10005970 3300025924 Bacteria 9332
35 Ga0207694_10048912 3300025924 Bacteria 3272
36 Ga0207694_10084908 3300025924 Unclassified 2491
37 Ga0207670_10247940 3300025936 Unclassified 1375
38 Ga0207667_10005560 3300025949 Bacteria 15380
39 Ga0207667_10127716 3300025949 Bacteria 2619
40 Ga0207667_10298520 3300025949 Bacteria 1646
41 Ga0207702_10001647 3300026078 Bacteria 22041
42 Ga0207641_10020865 3300026088 Bacteria 5385
43 Ga0207641_10029851 3300026088 Bacteria 4510
44 Ga0207641_10329031 3300026088 Unclassified 1451
45 Ga0207676_10087971 3300026095 Bacteria 2542
46 Ga0207674_10012719 3300026116 Bacteria 9405
47 Ga0265337_1000018 3300028556 Bacteria 76481
48 Ga0265337_1000622 3300028556 Bacteria 18726
49 Ga0265337_1003845 3300028556 Bacteria 6380
50 Ga0265337_1018457 3300028556 Bacteria 2215
51 Ga0265337_1020636 3300028556 Bacteria 2063
52 Ga0265337_1030093 3300028556 Bacteria 1619
53 Ga0265326_10009472 3300028558 Bacteria 2913
54 Ga0265319_1000001 3300028563 Bacteria 549513
55 Ga0265319_1002660 3300028563 Bacteria 9595
56 Ga0265319_1021655 3300028563 Bacteria 2356
57 Ga0265319_1028693 3300028563 Unclassified 1959
58 Ga0265334_10005317 3300028573 Bacteria 5627
59 Ga0265334_10036066 3300028573 Bacteria 1954
60 Ga0265334_10038687 3300028573 Bacteria 1875
61 Ga0265323_10028924 3300028653 Bacteria 2076
62 Ga0265336_10000383 3300028666 Bacteria 28214
63 Ga0265336_10014974 3300028666 Bacteria 2560
64 Ga0265336_10018896 3300028666 Unclassified 2228
65 Ga0265336_10044608 3300028666 Bacteria 1349
66 Ga0265338_10000032 3300028800 Bacteria 257580
67 Ga0265338_10000050 3300028800 Bacteria 213659
68 Ga0265338_10000440 3300028800 Bacteria 74544
69 Ga0265338_10001071 3300028800 Bacteria 45427
70 Ga0265338_10001288 3300028800 Bacteria 41141
71 Ga0265338_10001464 3300028800 Bacteria 38231
72 Ga0265338_10001684 3300028800 Bacteria 35127
73 Ga0265338_10001911 3300028800 Bacteria 32527
74 Ga0265338_10004730 3300028800 Bacteria 18212
75 Ga0265338_10006353 3300028800 Bacteria 15097
76 Ga0265338_10006473 3300028800 Bacteria 14919
77 Ga0265338_10007150 3300028800 Bacteria 13976
78 Ga0265338_10025253 3300028800 Bacteria 6037
79 Ga0265338_10030462 3300028800 Bacteria 5315
80 Ga0265338_10031867 3300028800 Bacteria 5158
81 Ga0265338_10033190 3300028800 Bacteria 5015
82 Ga0265338_10045549 3300028800 Bacteria 4031
83 Ga0265338_10069632 3300028800 Bacteria 3021
84 Ga0265338_10075655 3300028800 Bacteria 2856
85 Ga0265324_10000586 3300029957 Bacteria 24901
86 Ga0265324_10000892 3300029957 Bacteria 18980
87 Ga0265324_10017920 3300029957 Bacteria 2571
88 Ga0265324_10026147 3300029957 Bacteria 2067
89 Ga0265332_10018265 3300031238 Bacteria 3094
90 Ga0265320_10000480 3300031240 Bacteria 31225
91 Ga0265320_10001279 3300031240 Bacteria 18377
92 Ga0265340_10003058 3300031247 Bacteria 9509
93 Ga0265340_10011986 3300031247 Unclassified 4586
94 Ga0265339_10002866 3300031249 Bacteria 12212
95 Ga0265339_10027918 3300031249 Bacteria 3214
96 Ga0265339_10048791 3300031249 Bacteria 2321
97 Ga0265327_10000769 3300031251 Bacteria 49436
98 Ga0265327_10050324 3300031251 Unclassified 2180
99 Ga0265327_10087496 3300031251 Bacteria 1526
100 Ga0265316_10012966 3300031344 Bacteria 7437
101 Ga0265316_10015026 3300031344 Bacteria 6787
102 Ga0265316_10034466 3300031344 Bacteria 4112
103 Ga0265316_10043222 3300031344 Bacteria 3594
104 Ga0265316_10067128 3300031344 Bacteria 2774
105 Ga0265316_10089406 3300031344 Bacteria 2350
106 Ga0265316_10097564 3300031344 Unclassified 2237
107 Ga0265313_10002628 3300031595 Bacteria 15283
108 Ga0265313_10011593 3300031595 Bacteria 5467
109 Ga0265314_10000469 3300031711 Bacteria 53607
110 Ga0265342_10045760 3300031712 Bacteria 2632
111 Ga0373928_0000052 3300035084 Bacteria 20328
112 Ga0373929_0003177 3300035085 Bacteria 2977
113 Ga0373944_0000506 3300035089 Bacteria 9075
114 Ga0373951_0001225 3300035091 Bacteria 6788
115 Ga0373923_0076476 3300035111 Bacteria 1446
116 Ga0373932_0000001 3300035112 Bacteria 1459067
117 Ga0373954_0007029 3300035118 Bacteria 4909
118 Ga0373956_0010099 3300035119 Bacteria 3856
119 Ga0373962_0000058 3300035242 Bacteria 23873
120 Ga0373931_0000008 3300035691 Bacteria 362269
121 Ga0373931_0083036 3300035691 Bacteria 1772
122 Ga0373935_0001224 3300035692 Bacteria 14180
123 Ga0373935_0088369 3300035692 Bacteria 2025
124 Ga0373927_0023169 3300035695 Bacteria 4067
125 Ga0373927_0028149 3300035695 Bacteria 3667
126 Ga0373927_0033183 3300035695 Bacteria 3361
127 Ga0373933_0011147 3300035724 Bacteria 4945
128 Ga0373947_0028517 3300035725 Bacteria 3274
129 Ga0373937_0043674 3300036401 Bacteria 4093
130 Ga0373937_0062084 3300036401 Bacteria 3435
131 Ga0373937_0150781 3300036401 Unclassified 2178
132 Ga0373937_0180191 3300036401 Bacteria 1984
133 Ga0373925_0000513 3300037068 Bacteria 39022
134 Ga0373925_0013138 3300037068 Bacteria 5993
135 Ga0373925_0018448 3300037068 Bacteria 5071
136 Ga0451577_0020858 3300042876 Bacteria 6006
137 Ga0451577_0044686 3300042876 Bacteria 3966
138 Ga0453684_0004390 3300044712 Bacteria 29850
139 Ga0453684_0016297 3300044712 Bacteria 11637
140 Ga0453684_0034986 3300044712 Bacteria 6955
141 Ga0451576_0156198 3300045051 Bacteria 2380
142 Ga0451576_0207076 3300045051 Bacteria 2048
143 Ga0451576_0268869 3300045051 Unclassified 1782
144 Ga0451576_0298802 3300045051 Bacteria 1684
145 Ga0451576_0305061 3300045051 Bacteria 1665
146 Ga0495592_0000464 3300046454 Bacteria 30065
147 Ga0495592_0011331 3300046454 Bacteria 6744
148 Ga0495628_0000259 3300046516 Bacteria 47040
149 Ga0495630_0000063 3300046517 Bacteria 85919
150 Ga0495630_0058684 3300046517 Bacteria 2885
151 Ga0495652_0137245 3300046529 Bacteria 1928
152 Ga0495652_0226141 3300046529 Bacteria 1402
153 Ga0495640_0039703 3300046533 Bacteria 3301
154 Ga0495640_0075099 3300046533 Bacteria 2258
155 Ga0495586_0000009 3300046535 Bacteria 144639
156 Ga0495586_0001197 3300046535 Bacteria 14571
157 Ga0495586_0004098 3300046535 Bacteria 7808
158 Ga0495586_0019955 3300046535 Bacteria 3570
159 Ga0495645_0025518 3300046543 Bacteria 4290
160 Ga0495645_0057867 3300046543 Bacteria 2813
161 Ga0495667_0028007 3300046559 Bacteria 3794
162 Ga0495634_0013238 3300046642 Bacteria 5964
163 Ga0495634_0017447 3300046642 Bacteria 5121
164 Ga0495634_0060368 3300046642 Unclassified 2523
165 Ga0495599_0071029 3300046678 Bacteria 2173
166 Ga0495658_0139544 3300046683 Bacteria 1481
167 Ga0495613_0016462 3300046689 Bacteria 5506
168 Ga0495581_0166388 3300047315 Bacteria 1289
169 Ga0495674_0000451 3300047319 Bacteria 37104
170 Ga0495676_0004825 3300047321 Bacteria 12365
171 Ga0495680_0009594 3300047322 Bacteria 8694
172 Ga0495684_0066360 3300047471 Bacteria 2744
173 Ga0496115_0050730 3300048918 Bacteria 3325
174 Ga0501031_0000310 3300049568 Bacteria 27898
175 Ga0501032_0016794 3300049569 Bacteria 5143
176 Ga0501033_0011340 3300049570 Bacteria 6821
177 Ga0501033_0016534 3300049570 Bacteria 5584
178 Ga0501033_0038382 3300049570 Bacteria 3581
179 Ga0501036_0085694 3300049572 Unclassified 2663
180 Ga0501036_0363979 3300049572 Unclassified 1207
181 Ga0501037_0190674 3300049573 Unclassified 1451
182 Ga0501043_0060540 3300049579 Unclassified 2972
183 Ga0501035_0015673 3300049822 Bacteria 6996
184 Ga0501035_0055705 3300049822 Unclassified 3529
185 Ga0501035_0287784 3300049822 Bacteria 1387
186 Ga0501044_0000014 3300049823 Bacteria 244619
187 Ga0501044_0009191 3300049823 Bacteria 10795
188 nmdc:mga06r32_61830_c1 3300050510 Bacteria 3606
189 nmdc:mga08y16_185066_c1 3300050511 Bacteria 2162
190 nmdc:mga0n895_211095_c1 3300050512 Unclassified 1971
191 Ga0495601_0187323 3300053077 Bacteria 1353
192 Ga0097621_100026716
193 rootH2_10113708
194 Ga0070689_100289393
195 Ga0070714_100004992
196 Ga0070711_100007821
197 Ga0070681_10016810
198 Ga0070679_100418660
199 Ga0068855_100030781
200 Ga0068855_100160402
201 Ga0068857_100063839
202 Ga0068856_100000211
203 Ga0068856_100174873
204 Ga0068859_100103573
205 Ga0068864_100060361
206 Ga0068863_100087102
207 Ga0068871_100036756
208 Ga0075428_100002140
209 Ga0097620_100103575
210 Ga0105240_10008598
211 Ga0105240_10155921
212 Ga0111539_10198544
213 Ga0105242_10041884
214 Ga0105238_10013238
215 Ga0105238_10068067
216 Ga0157370_10020143
217 Ga0157372_10298747
218 Ga0157375_10000072
219 Ga0163163_10002586
220 Ga0157376_10129943
221 Ga0207695_10055988
222 Ga0207695_10072670
223 Ga0207652_10078946
224 Ga0207652_10361707
225 Ga0207694_10005970
226 Ga0207694_10048912
227 Ga0207694_10084908
228 Ga0207670_10247940
229 Ga0207667_10005560
230 Ga0207667_10127716
231 Ga0207667_10298520
232 Ga0207702_10001647
233 Ga0207641_10020865
234 Ga0207641_10029851
235 Ga0207641_10329031
236 Ga0207676_10087971
237 Ga0207674_10012719
238 Ga0265337_1000018
239 Ga0265337_1000622
240 Ga0265337_1003845
241 Ga0265337_1018457
242 Ga0265337_1020636
243 Ga0265337_1030093
244 Ga0265326_10009472
245 Ga0265319_1000001
246 Ga0265319_1002660
247 Ga0265319_1021655
248 Ga0265319_1028693
249 Ga0265334_10005317
250 Ga0265334_10036066
251 Ga0265334_10038687
252 Ga0265323_10028924
253 Ga0265336_10000383
254 Ga0265336_10014974
255 Ga0265336_10018896
256 Ga0265336_10044608
257 Ga0265338_10000032
258 Ga0265338_10000050
259 Ga0265338_10000440
260 Ga0265338_10001071
261 Ga0265338_10001288
262 Ga0265338_10001464
263 Ga0265338_10001684
264 Ga0265338_10001911
265 Ga0265338_10004730
266 Ga0265338_10006353
267 Ga0265338_10006473
268 Ga0265338_10007150
269 Ga0265338_10025253
270 Ga0265338_10030462
271 Ga0265338_10031867
272 Ga0265338_10033190
273 Ga0265338_10045549
274 Ga0265338_10069632
275 Ga0265338_10075655
276 Ga0265324_10000586
277 Ga0265324_10000892
278 Ga0265324_10017920
279 Ga0265324_10026147
280 Ga0265332_10018265
281 Ga0265320_10000480
282 Ga0265320_10001279
283 Ga0265340_10003058
284 Ga0265340_10011986
285 Ga0265339_10002866
286 Ga0265339_10027918
287 Ga0265339_10048791
288 Ga0265327_10000769
289 Ga0265327_10050324
290 Ga0265327_10087496
291 Ga0265316_10012966
292 Ga0265316_10015026
293 Ga0265316_10034466
294 Ga0265316_10043222
295 Ga0265316_10067128
296 Ga0265316_10089406
297 Ga0265316_10097564
298 Ga0265313_10002628
299 Ga0265313_10011593
300 Ga0265314_10000469
301 Ga0265342_10045760
302 Ga0373928_0000052
303 Ga0373929_0003177
304 Ga0373944_0000506
305 Ga0373951_0001225
306 Ga0373923_0076476
307 Ga0373932_0000001
308 Ga0373954_0007029
309 Ga0373956_0010099
310 Ga0373962_0000058
311 Ga0373931_0000008
312 Ga0373931_0083036
313 Ga0373935_0001224
314 Ga0373935_0088369
315 Ga0373927_0023169
316 Ga0373927_0028149
317 Ga0373927_0033183
318 Ga0373933_0011147
319 Ga0373947_0028517
320 Ga0373937_0043674
321 Ga0373937_0062084
322 Ga0373937_0150781
323 Ga0373937_0180191
324 Ga0373925_0000513
325 Ga0373925_0013138
326 Ga0373925_0018448
327 Ga0451577_0020858
328 Ga0451577_0044686
329 Ga0453684_0004390
330 Ga0453684_0016297
331 Ga0453684_0034986
332 Ga0451576_0156198
333 Ga0451576_0207076
334 Ga0451576_0268869
335 Ga0451576_0298802
336 Ga0451576_0305061
337 Ga0495592_0000464
338 Ga0495592_0011331
339 Ga0495628_0000259
340 Ga0495630_0000063
341 Ga0495630_0058684
342 Ga0495652_0137245
343 Ga0495652_0226141
344 Ga0495640_0039703
345 Ga0495640_0075099
346 Ga0495586_0000009
347 Ga0495586_0001197
348 Ga0495586_0004098
349 Ga0495586_0019955
350 Ga0495645_0025518
351 Ga0495645_0057867
352 Ga0495667_0028007
353 Ga0495634_0013238
354 Ga0495634_0017447
355 Ga0495634_0060368
356 Ga0495599_0071029
357 Ga0495658_0139544
358 Ga0495613_0016462
359 Ga0495581_0166388
360 Ga0495674_0000451
361 Ga0495676_0004825
362 Ga0495680_0009594
363 Ga0495684_0066360
364 Ga0496115_0050730
365 Ga0501031_0000310
366 Ga0501032_0016794
367 Ga0501033_0011340
368 Ga0501033_0016534
369 Ga0501033_0038382
370 Ga0501036_0085694
371 Ga0501036_0363979
372 Ga0501037_0190674
373 Ga0501043_0060540
374 Ga0501035_0015673
375 Ga0501035_0055705
376 Ga0501035_0287784
377 Ga0501044_0000014
378 Ga0501044_0009191
379 nmdc:mga06r32_61830_c1
380 nmdc:mga08y16_185066_c1
381 nmdc:mga0n895_211095_c1
382 Ga0495601_0187323

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

50

405

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b87-assembly1.cif.gz_A crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution 0.9104 11 381
5b7s-assembly1.cif.gz_A apo structure of cysteine desulfurase from thermococcus onnurineus na1 0.9039 10 381
6c9e-assembly1.cif.gz_A crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1 0.8993 10 381
1elu-assembly1.cif.gz_B complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. 0.898 17 380
6wci-assembly1.cif.gz_A crystal structure of a cysteine desulfurase sufs from stenotrophomonas maltophilia k279a 0.8975 7 381
ID Description Score Start End Superfamily
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9054 38 279 3.40.640.10
1elqB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8846 38 285 3.40.640.10
af_Q0INV6_1_200_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8776 82 276 3.40.640.10
af_A0A368UH16_90_350_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.872 35 286 3.40.640.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.868 38 279 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A3C0DTZ7-F1-model_v4 Aminotransferase 0.9769 1 382 GO:0008483
AF-A0A3C0DTZ7-F1-model_v4 Aminotransferase 0.9744 1 382 GO:0008483
AF-A0A7C8DHS0-F1-model_v4 deleted 0.9722 2 237
AF-A0A2D6V5W1-F1-model_v4 deleted 0.9394 17 382
AF-A0A524LP53-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9393 1 381 GO:0008483

Map