F293610

General Info

Members Datasets Scaffolds Average Seq Length
191 130 382 299

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100181552|Ga0070659_1001815522
Length 315
Sequence MPAAKMQPHVRVWHPDWPCPVGTVLSTHRRGPSDPTFRTTTDGAIWRGIRSPEGPVTLRLVGDPAAGTVTGQAWGSGAEWILEQMPRMLGADDDCSGFEPKHQPIVDAWRRHRHWRLGATDLVMESLVPAVIEQKVTGREAFGAFRRLVHRFGERAPGPPGQLDPEVRLWVQPAPTDLRSIPSWEWLRLPVDGARSRPIQHAARVAPALERAGRETPEEFDRRARTLPGIGVWTSAEVRSRAMGDPDSVSFGDFHIAANVGYVLTGEPVDDAGLASLLEPYAGHRHRIQRLVELAGWSRPRRGPRVAPRTHLPSA

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
123 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 2643221615 Nocardioides sp. Root224 Isolate Unclassified
129 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
130 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 0
Rhizoplane 5.76
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100181552 3300005366 Bacteria 1727
2 Ga0070658_10064239 3300005327 Bacteria 2994
3 Ga0070658_10124902 3300005327 Bacteria 2141
4 Ga0070658_10428588 3300005327 Bacteria 1138
5 Ga0070683_100007862 3300005329 Bacteria 9033
6 Ga0070683_100296104 3300005329 Bacteria 1539
7 Ga0070682_100312285 3300005337 Bacteria 1158
8 Ga0070687_100272919 3300005343 Bacteria 1061
9 Ga0070661_100317467 3300005344 Bacteria 1216
10 Ga0070659_100129321 3300005366 Bacteria 2050
11 Ga0070659_100359332 3300005366 Bacteria 1223
12 Ga0070700_100097876 3300005441 Bacteria 1928
13 Ga0070694_100227749 3300005444 Bacteria 1401
14 Ga0070663_100126835 3300005455 Bacteria 1934
15 Ga0070662_100025619 3300005457 Bacteria 4075
16 Ga0070679_100006112 3300005530 Bacteria 11200
17 Ga0070684_100000534 3300005535 Bacteria 26083
18 Ga0070684_100535967 3300005535 Bacteria 1086
19 Ga0070693_100077820 3300005547 Bacteria 1969
20 Ga0070665_100165484 3300005548 Bacteria 2214
21 Ga0068855_100206455 3300005563 Bacteria 2210
22 Ga0068857_100006347 3300005577 Bacteria 10123
23 Ga0068856_100108801 3300005614 Bacteria 2768
24 Ga0068861_100072061 3300005719 Bacteria 2680
25 Ga0068860_100000334 3300005843 Bacteria 63958
26 Ga0081539_10023054 3300005985 Bacteria 4091
27 Ga0075365_10010556 3300006038 Bacteria 5385
28 Ga0075365_10027372 3300006038 Bacteria 3628
29 Ga0075368_10001245 3300006042 Bacteria 8051
30 Ga0075368_10023398 3300006042 Bacteria 2360
31 Ga0075363_100009537 3300006048 Bacteria 4565
32 Ga0075363_100031191 3300006048 Bacteria 2762
33 Ga0075363_100048613 3300006048 Bacteria 2256
34 Ga0075363_100062085 3300006048 Bacteria 2015
35 Ga0075367_10009955 3300006178 Bacteria 4982
36 Ga0075370_10040864 3300006353 Bacteria 2617
37 Ga0068865_100109325 3300006881 Bacteria 2037
38 Ga0111539_10092496 3300009094 Bacteria 3554
39 Ga0105245_10013711 3300009098 Bacteria 7060
40 Ga0105245_10689993 3300009098 Bacteria 1054
41 Ga0105243_10027044 3300009148 Bacteria 4394
42 Ga0105243_10090738 3300009148 Bacteria 2515
43 Ga0105243_10192929 3300009148 Bacteria 1780
44 Ga0105243_10481578 3300009148 Bacteria 1171
45 Ga0105249_10231592 3300009553 Bacteria 1822
46 Ga0105239_10009129 3300010375 Bacteria 11218
47 Ga0105239_10665912 3300010375 Bacteria 1189
48 Ga0105246_10006156 3300011119 Bacteria 7322
49 Ga0163162_10338946 3300013306 Bacteria 1636
50 Ga0157372_10020906 3300013307 Bacteria 7065
51 Ga0157375_10024149 3300013308 Bacteria 5622
52 Ga0163163_10583010 3300014325 Bacteria 1181
53 Ga0157380_10132383 3300014326 Bacteria 2129
54 Ga0157377_10351521 3300014745 Bacteria 989
55 Ga0207705_10060906 3300025909 Bacteria 2726
56 Ga0207705_10218485 3300025909 Bacteria 1447
57 Ga0207657_10003212 3300025919 Bacteria 17497
58 Ga0207649_10216495 3300025920 Bacteria 1362
59 Ga0207652_10004665 3300025921 Bacteria 11112
60 Ga0207659_10299164 3300025926 Bacteria 1321
61 Ga0207687_10161680 3300025927 Bacteria 1719
62 Ga0207690_10114897 3300025932 Bacteria 1944
63 Ga0207690_10204517 3300025932 Bacteria 1502
64 Ga0207706_10042335 3300025933 Bacteria 4037
65 Ga0207709_10056605 3300025935 Bacteria 2427
66 Ga0207704_10039121 3300025938 Bacteria 2758
67 Ga0207661_10077460 3300025944 Bacteria 2734
68 Ga0207667_10396627 3300025949 Bacteria 1405
69 Ga0207712_10370876 3300025961 Bacteria 1195
70 Ga0207658_10016176 3300025986 Bacteria 5126
71 Ga0207658_10237152 3300025986 Bacteria 1543
72 Ga0207708_10019578 3300026075 Bacteria 5102
73 Ga0207702_10055390 3300026078 Bacteria 3363
74 Ga0207674_10011041 3300026116 Bacteria 10158
75 Ga0207683_10167082 3300026121 Bacteria 1991
76 Ga0207683_10401354 3300026121 Bacteria 1261
77 Ga0268266_10007408 3300028379 Bacteria 9907
78 Ga0268266_10067409 3300028379 Bacteria 3098
79 Ga0268265_10340831 3300028380 Bacteria 1365
80 Ga0268264_10000417 3300028381 Bacteria 60164
81 Ga0268264_10263007 3300028381 Bacteria 1608
82 Ga0307405_10105695 3300031731 Bacteria 1897
83 Ga0307405_10408557 3300031731 Bacteria 1065
84 Ga0307409_100069406 3300031995 Bacteria 2792
85 Ga0307416_100039129 3300032002 Bacteria 3668
86 Ga0307416_100473045 3300032002 Bacteria 1311
87 Ga0307414_10225036 3300032004 Bacteria 1543
88 Ga0307415_100035856 3300032126 Bacteria 3244
89 Ga0307415_100044654 3300032126 Bacteria 2964
90 Ga0439448_0108684 3300042005 Bacteria 946
91 Ga0439464_0022468 3300042439 Bacteria 1738
92 Ga0466972_0013320 3300044658 Bacteria 4129
93 Ga0466972_0030945 3300044658 Bacteria 2634
94 Ga0466965_0009976 3300044683 Bacteria 4418
95 Ga0466965_0030542 3300044683 Bacteria 2626
96 Ga0466966_0030388 3300044684 Bacteria 3508
97 Ga0466961_0012012 3300044693 Bacteria 5534
98 Ga0466961_0152486 3300044693 Bacteria 1442
99 Ga0466963_0044693 3300044694 Bacteria 2916
100 Ga0466963_0132769 3300044694 Bacteria 1721
101 Ga0466971_0007712 3300044719 Bacteria 4693
102 Ga0466970_0012918 3300044765 Bacteria 4276
103 Ga0466970_0099105 3300044765 Bacteria 1586
104 Ga0466960_0003649 3300044901 Bacteria 5938
105 Ga0466960_0019061 3300044901 Bacteria 3016
106 Ga0466960_0064729 3300044901 Bacteria 1804
107 Ga0466960_0084804 3300044901 Bacteria 1603
108 Ga0466960_0141693 3300044901 Bacteria 1278
109 Ga0451576_0730953 3300045051 Bacteria 1040
110 Ga0466967_0024374 3300045976 Bacteria 4973
111 Ga0466967_0052261 3300045976 Bacteria 3585
112 Ga0466967_0321645 3300045976 Bacteria 1492
113 Ga0495664_0080107 3300046477 Bacteria 1957
114 Ga0496102_0044583 3300048905 Bacteria 4026
115 Ga0496102_0259405 3300048905 Bacteria 1639
116 Ga0496107_0077313 3300048910 Bacteria 2424
117 Ga0496108_0020551 3300048911 Bacteria 5427
118 Ga0496109_0329470 3300048912 Bacteria 1441
119 Ga0496110_0075908 3300048913 Bacteria 2987
120 Ga0496110_0086349 3300048913 Bacteria 2801
121 Ga0496111_0002064 3300048914 Bacteria 11967
122 Ga0496113_0138511 3300048916 Bacteria 1914
123 Ga0496114_0002783 3300048917 Bacteria 13389
124 Ga0496115_0007106 3300048918 Bacteria 8222
125 Ga0501031_0013384 3300049568 Bacteria 5353
126 Ga0501032_0024341 3300049569 Bacteria 4182
127 Ga0501034_0019879 3300049571 Bacteria 6861
128 Ga0501036_0002703 3300049572 Bacteria 14003
129 Ga0501036_0017438 3300049572 Bacteria 6003
130 Ga0501036_0021113 3300049572 Bacteria 5469
131 Ga0501037_0010561 3300049573 Bacteria 6783
132 Ga0501037_0095883 3300049573 Bacteria 2144
133 Ga0501037_0263159 3300049573 Bacteria 1205
134 Ga0501038_0005316 3300049574 Bacteria 11964
135 Ga0501038_0016900 3300049574 Bacteria 6603
136 Ga0501039_0013209 3300049575 Bacteria 6312
137 Ga0501039_0075382 3300049575 Bacteria 2622
138 Ga0501039_0092064 3300049575 Bacteria 2363
139 Ga0501040_0022400 3300049576 Bacteria 4227
140 Ga0501040_0155446 3300049576 Bacteria 1615
141 Ga0501041_0007646 3300049577 Bacteria 6347
142 Ga0501041_0181070 3300049577 Bacteria 1319
143 Ga0501042_0012400 3300049578 Bacteria 5774
144 Ga0501042_0229458 3300049578 Bacteria 1339
145 Ga0501043_0302812 3300049579 Bacteria 1221
146 Ga0501046_0017993 3300049580 Bacteria 5890
147 Ga0501046_0033893 3300049580 Bacteria 4124
148 Ga0501047_0050228 3300049581 Bacteria 4027
149 Ga0501048_0037206 3300049582 Bacteria 3495
150 Ga0501067_0064794 3300049583 Bacteria 2023
151 Ga0501067_0114619 3300049583 Bacteria 1499
152 Ga0501070_0189049 3300049586 Bacteria 1693
153 Ga0501071_0003739 3300049587 Bacteria 9559
154 Ga0501072_0095998 3300049588 Bacteria 2356
155 Ga0501073_0041824 3300049589 Bacteria 3237
156 Ga0501074_0011660 3300049590 Bacteria 6389
157 Ga0501074_0158769 3300049590 Bacteria 1615
158 Ga0501075_0099558 3300049591 Bacteria 2207
159 Ga0501076_0017995 3300049592 Bacteria 5376
160 Ga0501077_0181496 3300049593 Bacteria 1338
161 Ga0501080_0263606 3300049742 Bacteria 1569
162 Ga0501081_0018188 3300049743 Bacteria 4665
163 Ga0501083_0235800 3300049744 Bacteria 1191
164 Ga0501035_0041646 3300049822 Bacteria 4147
165 Ga0501035_0078045 3300049822 Bacteria 2926
166 Ga0501044_0081687 3300049823 Bacteria 3271
167 Ga0501044_0346723 3300049823 Bacteria 1405
168 Ga0501045_0043422 3300049824 Bacteria 3273
169 Ga0501045_0121003 3300049824 Bacteria 1944
170 nmdc:mga03n38_15438_c1 3300050490 Bacteria 2949
171 nmdc:mga03n38_174351_c1 3300050490 Bacteria 1098
172 nmdc:mga03n38_56333_c1 3300050490 Bacteria 1774
173 nmdc:mga00v17_51022_c1 3300050491 Bacteria 2515
174 nmdc:mga00v17_72202_c1 3300050491 Bacteria 2141
175 nmdc:mga0yw44_14712_c1 3300050492 Bacteria 4165
176 nmdc:mga0yw44_16091_c1 3300050492 Bacteria 4031
177 nmdc:mga0yw44_192260_c1 3300050492 Bacteria 1346
178 nmdc:mga0yw44_30717_c1 3300050492 Bacteria 3117
179 nmdc:mga0yw44_34572_c1 3300050492 Bacteria 2962
180 nmdc:mga06z11_49643_c1 3300050494 Bacteria 2142
181 nmdc:mga07m45_45661_c1 3300050496 Bacteria 2460
182 Ga0500644_0000014 3300053088 Bacteria 109650
183 Ga0500554_064759 3300053102 Bacteria 1180
184 Ga0500593_000305 3300053117 Bacteria 19941
185 Ga0500573_0063602 3300053140 Bacteria 2111
186 Ga0501082_0101006 3300060353 Bacteria 2495
187 Ga0466962_0011833 3300061719 Bacteria 4199
188 Ga0530510_0056022 3300061734 Bacteria 2848
189 2644089354 2643221615 Bacteria 5487866
190 2644319199 2643221657 Bacteria 5490246
191 2855386956 2855386786 Bacteria 4752232
192 Ga0070659_100181552
193 Ga0070658_10064239
194 Ga0070658_10124902
195 Ga0070658_10428588
196 Ga0070683_100007862
197 Ga0070683_100296104
198 Ga0070682_100312285
199 Ga0070687_100272919
200 Ga0070661_100317467
201 Ga0070659_100129321
202 Ga0070659_100359332
203 Ga0070700_100097876
204 Ga0070694_100227749
205 Ga0070663_100126835
206 Ga0070662_100025619
207 Ga0070679_100006112
208 Ga0070684_100000534
209 Ga0070684_100535967
210 Ga0070693_100077820
211 Ga0070665_100165484
212 Ga0068855_100206455
213 Ga0068857_100006347
214 Ga0068856_100108801
215 Ga0068861_100072061
216 Ga0068860_100000334
217 Ga0081539_10023054
218 Ga0075365_10010556
219 Ga0075365_10027372
220 Ga0075368_10001245
221 Ga0075368_10023398
222 Ga0075363_100009537
223 Ga0075363_100031191
224 Ga0075363_100048613
225 Ga0075363_100062085
226 Ga0075367_10009955
227 Ga0075370_10040864
228 Ga0068865_100109325
229 Ga0111539_10092496
230 Ga0105245_10013711
231 Ga0105245_10689993
232 Ga0105243_10027044
233 Ga0105243_10090738
234 Ga0105243_10192929
235 Ga0105243_10481578
236 Ga0105249_10231592
237 Ga0105239_10009129
238 Ga0105239_10665912
239 Ga0105246_10006156
240 Ga0163162_10338946
241 Ga0157372_10020906
242 Ga0157375_10024149
243 Ga0163163_10583010
244 Ga0157380_10132383
245 Ga0157377_10351521
246 Ga0207705_10060906
247 Ga0207705_10218485
248 Ga0207657_10003212
249 Ga0207649_10216495
250 Ga0207652_10004665
251 Ga0207659_10299164
252 Ga0207687_10161680
253 Ga0207690_10114897
254 Ga0207690_10204517
255 Ga0207706_10042335
256 Ga0207709_10056605
257 Ga0207704_10039121
258 Ga0207661_10077460
259 Ga0207667_10396627
260 Ga0207712_10370876
261 Ga0207658_10016176
262 Ga0207658_10237152
263 Ga0207708_10019578
264 Ga0207702_10055390
265 Ga0207674_10011041
266 Ga0207683_10167082
267 Ga0207683_10401354
268 Ga0268266_10007408
269 Ga0268266_10067409
270 Ga0268265_10340831
271 Ga0268264_10000417
272 Ga0268264_10263007
273 Ga0307405_10105695
274 Ga0307405_10408557
275 Ga0307409_100069406
276 Ga0307416_100039129
277 Ga0307416_100473045
278 Ga0307414_10225036
279 Ga0307415_100035856
280 Ga0307415_100044654
281 Ga0439448_0108684
282 Ga0439464_0022468
283 Ga0466972_0013320
284 Ga0466972_0030945
285 Ga0466965_0009976
286 Ga0466965_0030542
287 Ga0466966_0030388
288 Ga0466961_0012012
289 Ga0466961_0152486
290 Ga0466963_0044693
291 Ga0466963_0132769
292 Ga0466971_0007712
293 Ga0466970_0012918
294 Ga0466970_0099105
295 Ga0466960_0003649
296 Ga0466960_0019061
297 Ga0466960_0064729
298 Ga0466960_0084804
299 Ga0466960_0141693
300 Ga0451576_0730953
301 Ga0466967_0024374
302 Ga0466967_0052261
303 Ga0466967_0321645
304 Ga0495664_0080107
305 Ga0496102_0044583
306 Ga0496102_0259405
307 Ga0496107_0077313
308 Ga0496108_0020551
309 Ga0496109_0329470
310 Ga0496110_0075908
311 Ga0496110_0086349
312 Ga0496111_0002064
313 Ga0496113_0138511
314 Ga0496114_0002783
315 Ga0496115_0007106
316 Ga0501031_0013384
317 Ga0501032_0024341
318 Ga0501034_0019879
319 Ga0501036_0002703
320 Ga0501036_0017438
321 Ga0501036_0021113
322 Ga0501037_0010561
323 Ga0501037_0095883
324 Ga0501037_0263159
325 Ga0501038_0005316
326 Ga0501038_0016900
327 Ga0501039_0013209
328 Ga0501039_0075382
329 Ga0501039_0092064
330 Ga0501040_0022400
331 Ga0501040_0155446
332 Ga0501041_0007646
333 Ga0501041_0181070
334 Ga0501042_0012400
335 Ga0501042_0229458
336 Ga0501043_0302812
337 Ga0501046_0017993
338 Ga0501046_0033893
339 Ga0501047_0050228
340 Ga0501048_0037206
341 Ga0501067_0064794
342 Ga0501067_0114619
343 Ga0501070_0189049
344 Ga0501071_0003739
345 Ga0501072_0095998
346 Ga0501073_0041824
347 Ga0501074_0011660
348 Ga0501074_0158769
349 Ga0501075_0099558
350 Ga0501076_0017995
351 Ga0501077_0181496
352 Ga0501080_0263606
353 Ga0501081_0018188
354 Ga0501083_0235800
355 Ga0501035_0041646
356 Ga0501035_0078045
357 Ga0501044_0081687
358 Ga0501044_0346723
359 Ga0501045_0043422
360 Ga0501045_0121003
361 nmdc:mga03n38_15438_c1
362 nmdc:mga03n38_174351_c1
363 nmdc:mga03n38_56333_c1
364 nmdc:mga00v17_51022_c1
365 nmdc:mga00v17_72202_c1
366 nmdc:mga0yw44_14712_c1
367 nmdc:mga0yw44_16091_c1
368 nmdc:mga0yw44_192260_c1
369 nmdc:mga0yw44_30717_c1
370 nmdc:mga0yw44_34572_c1
371 nmdc:mga06z11_49643_c1
372 nmdc:mga07m45_45661_c1
373 Ga0500644_0000014
374 Ga0500554_064759
375 Ga0500593_000305
376 Ga0500573_0063602
377 Ga0501082_0101006
378 Ga0466962_0011833
379 Ga0530510_0056022
380 2644089354
381 2644319199
382 2855386956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jhj-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.8149 1 277
3cvs-assembly1.cif.gz_D crystal structure of an alka host/guest complex 8oxoguanine:adenine base pair 0.8107 2 285
3ogd-assembly1.cif.gz_A alka undamaged dna complex: interrogation of a g*:c base pair 0.7966 2 284
3oh6-assembly1.cif.gz_A alka undamaged dna complex: interrogation of a c:g base pair 0.7955 2 284
3cvs-assembly1.cif.gz_D crystal structure of an alka host/guest complex 8oxoguanine:adenine base pair 0.7951 2 285
ID Description Score Start End Superfamily
af_P96819_122_235_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9032 114 220 1.10.340.30
af_P96819_1_121_3.30.310.20 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;DNA-3-methyladenine glycosylase AlkA, N-terminal domain 0.8988 1 109 3.30.310.20
af_P96819_122_235_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8426 114 220 1.10.340.30
2jhnB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8409 109 226 1.10.340.30
af_P9WJW3_319_432_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8278 116 226 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A847KK36-F1-model_v4 DNA-3-methyladenine glycosylase 2 family protein 0.981 2 277 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A2W2FNJ6-F1-model_v4 3-methyladenine DNA glycosylase 0.9651 2 281 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A7K0A4E1-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9635 27 287 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A101Q1G3-F1-model_v4 deleted 0.9623 2 288
AF-A0A4V1TIY8-F1-model_v4 DNA-3-methyladenine glycosylase 2 family protein 0.9618 11 260 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map