F293478

General Info

Members Datasets Scaffolds Average Seq Length
191 128 380 261

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10109792|Ga0065712_101097923
Length 287
Sequence VHTGFHWPSAERVRSGGRLWLIAAAVLVGMMVTAFAQRPRFGSSPDRVHPGSNIAYDGRFTFVRLNYTTLPGGYFYGGMPAWAHGYPIAEQNLMRIMNEVSYLAPHIDDINSVRADDPALFHYPIAYVIEVDWWDMTDAEARNLRAYLQKGGFLIVDDFKVRGGFGRFGGRGADSGAGGGLEAFETNMKRVVPEGRFVALDPSQPIFHSFFEIKSLDNFPQAYIAGQPVFRGLFEDNDPRKRLMVIENYNTDISQFWEWSGRGLRPFDDTNEAYKLGINYLIYGMTH

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.71
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 19.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10109792 3300005290 Bacteria 1849
2 JGI24751J29686_10027451 3300002459 Eukaryota 1182
3 Ga0065707_10294224 3300005295 Bacteria 1018
4 Ga0065707_10303088 3300005295 Bacteria 1000
5 Ga0070676_10135928 3300005328 Bacteria 1560
6 Ga0070683_100292159 3300005329 Bacteria 1550
7 Ga0070670_100161380 3300005331 Bacteria 1942
8 Ga0070670_100181571 3300005331 Bacteria 1827
9 Ga0070677_10008512 3300005333 Bacteria 3455
10 Ga0070682_100144159 3300005337 Bacteria 1627
11 Ga0070660_100011243 3300005339 Bacteria 6353
12 Ga0070671_100533858 3300005355 Unclassified 1011
13 Ga0070673_100020301 3300005364 Bacteria 4791
14 Ga0070659_100191777 3300005366 Bacteria 1680
15 Ga0070705_100162832 3300005440 Unclassified 1493
16 Ga0070694_100011143 3300005444 Bacteria 5568
17 Ga0070681_10005459 3300005458 Bacteria 12282
18 Ga0070681_10213252 3300005458 Unclassified 1847
19 Ga0068867_100500263 3300005459 Bacteria 1044
20 Ga0070707_100109655 3300005468 Bacteria 2677
21 Ga0070707_100290691 3300005468 Bacteria 1588
22 Ga0070707_100304877 3300005468 Bacteria 1548
23 Ga0070698_100038417 3300005471 Bacteria 4932
24 Ga0070679_100101679 3300005530 Bacteria 2861
25 Ga0070679_100126915 3300005530 Bacteria 2533
26 Ga0070695_100004568 3300005545 Bacteria 8119
27 Ga0070695_100083106 3300005545 Bacteria 2121
28 Ga0070665_100001812 3300005548 Bacteria 24235
29 Ga0070665_100184718 3300005548 Bacteria 2086
30 Ga0070704_100011841 3300005549 Bacteria 5367
31 Ga0068859_100003822 3300005617 Bacteria 15377
32 Ga0068859_100009861 3300005617 Bacteria 9643
33 Ga0068859_100072615 3300005617 Unclassified 3478
34 Ga0068859_100209205 3300005617 Bacteria 2037
35 Ga0068864_100002710 3300005618 Bacteria 14582
36 Ga0068864_100015556 3300005618 Bacteria 6328
37 Ga0068866_10099272 3300005718 Bacteria 1603
38 Ga0068863_100416956 3300005841 Bacteria 1315
39 Ga0068858_100010011 3300005842 Bacteria 9005
40 Ga0068858_100016758 3300005842 Bacteria 6881
41 Ga0068858_100672345 3300005842 Bacteria 1007
42 Ga0068858_100756745 3300005842 Bacteria 947
43 Ga0068860_100019956 3300005843 Bacteria 6498
44 Ga0070715_10071946 3300006163 Bacteria 1547
45 Ga0097621_100028727 3300006237 Bacteria 4386
46 Ga0097621_100048417 3300006237 Bacteria 3448
47 Ga0097621_100164706 3300006237 Unclassified 1908
48 Ga0068871_100106083 3300006358 Bacteria 2358
49 Ga0068871_100129524 3300006358 Unclassified 2138
50 Ga0068871_100394866 3300006358 Bacteria 1231
51 Ga0075431_100615634 3300006847 Bacteria 1069
52 Ga0075433_10062578 3300006852 Bacteria 3259
53 Ga0075433_10116045 3300006852 Bacteria 2375
54 Ga0075433_10401248 3300006852 Bacteria 1210
55 Ga0075434_100319606 3300006871 Bacteria 1573
56 Ga0075429_100161091 3300006880 Bacteria 1965
57 Ga0068865_100329131 3300006881 Unclassified 1231
58 Ga0097620_100003822 3300006931 Bacteria 15377
59 Ga0097620_100009861 3300006931 Bacteria 9643
60 Ga0097620_100072615 3300006931 Unclassified 3478
61 Ga0097620_100209207 3300006931 Bacteria 2037
62 Ga0075435_100057838 3300007076 Bacteria 3137
63 Ga0111539_10004260 3300009094 Bacteria 18729
64 Ga0111539_10017055 3300009094 Bacteria 8990
65 Ga0111539_10818370 3300009094 Bacteria 1084
66 Ga0105245_10005879 3300009098 Bacteria 10777
67 Ga0105245_10414312 3300009098 Bacteria 1349
68 Ga0105247_10061732 3300009101 Bacteria 2324
69 Ga0114129_10001471 3300009147 Bacteria 31879
70 Ga0114129_10163817 3300009147 Bacteria 3036
71 Ga0114129_10221419 3300009147 Bacteria 2552
72 Ga0114129_10693874 3300009147 Bacteria 1309
73 Ga0105248_10032828 3300009177 Bacteria 5800
74 Ga0105248_10082957 3300009177 Bacteria 3605
75 Ga0105248_10124948 3300009177 Unclassified 2902
76 Ga0105248_10236028 3300009177 Unclassified 2059
77 Ga0105248_10489647 3300009177 Bacteria 1386
78 Ga0105248_10551437 3300009177 Bacteria 1300
79 Ga0105237_10309124 3300009545 Bacteria 1584
80 Ga0105249_10367163 3300009553 Unclassified 1462
81 Ga0157378_10132691 3300013297 Bacteria 2307
82 Ga0163162_10613216 3300013306 Bacteria 1214
83 Ga0157375_10413450 3300013308 Unclassified 1515
84 Ga0163163_10003744 3300014325 Bacteria 12948
85 Ga0163163_10021922 3300014325 Bacteria 6037
86 Ga0163163_10064081 3300014325 Bacteria 3647
87 Ga0157380_10123988 3300014326 Unclassified 2193
88 Ga0157380_10864043 3300014326 Unclassified 927
89 Ga0157379_10012931 3300014968 Bacteria 7302
90 Ga0157379_10111512 3300014968 Bacteria 2457
91 Ga0157376_10550807 3300014969 Bacteria 1141
92 Ga0207710_10065800 3300025900 Bacteria 1653
93 Ga0207707_10022097 3300025912 Bacteria 5561
94 Ga0207707_10092107 3300025912 Bacteria 2649
95 Ga0207660_10099307 3300025917 Bacteria 2172
96 Ga0207652_10090407 3300025921 Bacteria 2690
97 Ga0207646_10048167 3300025922 Bacteria 3821
98 Ga0207646_10056147 3300025922 Bacteria 3520
99 Ga0207650_10116880 3300025925 Bacteria 2072
100 Ga0207687_10046255 3300025927 Bacteria 3012
101 Ga0207644_10340549 3300025931 Unclassified 1216
102 Ga0207686_10071025 3300025934 Bacteria 2239
103 Ga0207669_10484891 3300025937 Bacteria 986
104 Ga0207691_10071568 3300025940 Bacteria 3129
105 Ga0207711_10052651 3300025941 Bacteria 3489
106 Ga0207711_10089317 3300025941 Unclassified 2707
107 Ga0207711_10115621 3300025941 Bacteria 2391
108 Ga0207711_10157319 3300025941 Bacteria 2055
109 Ga0207711_10186967 3300025941 Bacteria 1886
110 Ga0207711_10228051 3300025941 Bacteria 1705
111 Ga0207689_10233942 3300025942 Bacteria 1519
112 Ga0207679_10073326 3300025945 Unclassified 2590
113 Ga0207679_10519315 3300025945 Bacteria 1065
114 Ga0207651_10005050 3300025960 Bacteria 6731
115 Ga0207640_10078547 3300025981 Bacteria 2247
116 Ga0207658_10394580 3300025986 Bacteria 1215
117 Ga0207677_10011299 3300026023 Bacteria 5085
118 Ga0207703_10032732 3300026035 Bacteria 4116
119 Ga0207703_10037221 3300026035 Unclassified 3876
120 Ga0207703_10721487 3300026035 Bacteria 949
121 Ga0207641_10236265 3300026088 Bacteria 1701
122 Ga0207676_10489325 3300026095 Bacteria 1166
123 Ga0207675_100561539 3300026118 Bacteria 1141
124 Ga0207683_10216001 3300026121 Bacteria 1746
125 Ga0207428_10027266 3300027907 Bacteria 4758
126 Ga0268266_10243720 3300028379 Unclassified 1660
127 Ga0268266_10379934 3300028379 Bacteria 1332
128 Ga0268265_10420854 3300028380 Bacteria 1240
129 Ga0268264_10166298 3300028381 Bacteria 1991
130 Ga0268264_10590062 3300028381 Unclassified 1094
131 Ga0268264_10680662 3300028381 Unclassified 1020
132 Ga0265334_10021704 3300028573 Bacteria 2621
133 Ga0307408_100149579 3300031548 Bacteria 1842
134 Ga0265314_10012086 3300031711 Bacteria 7075
135 Ga0307413_10062110 3300031824 Bacteria 2309
136 Ga0373955_0112357 3300035172 Bacteria 1576
137 Ga0373933_0076745 3300035724 Unclassified 2042
138 Ga0373937_0056255 3300036401 Bacteria 3613
139 Ga0373937_0086309 3300036401 Unclassified 2904
140 Ga0373937_0103061 3300036401 Bacteria 2650
141 Ga0373937_0530236 3300036401 Bacteria 1119
142 Ga0373937_0583511 3300036401 Unclassified 1061
143 Ga0373925_0572128 3300037068 Bacteria 930
144 Ga0466967_0859036 3300045976 Bacteria 902
145 Ga0495628_0056903 3300046516 Bacteria 3077
146 Ga0495628_0094097 3300046516 Bacteria 2317
147 Ga0495628_0274664 3300046516 Bacteria 1253
148 Ga0495652_0212601 3300046529 Bacteria 1459
149 Ga0495586_0049741 3300046535 Unclassified 2267
150 Ga0495621_0023634 3300046539 Bacteria 2046
151 Ga0495667_0004006 3300046559 Bacteria 9893
152 Ga0495634_0143078 3300046642 Bacteria 1517
153 Ga0495635_0057662 3300046663 Unclassified 2672
154 Ga0495599_0185455 3300046678 Unclassified 1281
155 Ga0495658_0212380 3300046683 Bacteria 1210
156 Ga0495613_0230210 3300046689 Unclassified 1299
157 Ga0495674_0473234 3300047319 Bacteria 1005
158 Ga0495684_0082036 3300047471 Unclassified 2447
159 Ga0496101_0141107 3300048904 Bacteria 1836
160 Ga0496104_0182808 3300048907 Bacteria 2007
161 Ga0496106_0050748 3300048909 Bacteria 3127
162 Ga0496107_0280788 3300048910 Bacteria 1240
163 Ga0496108_0344608 3300048911 Bacteria 1300
164 Ga0496109_0311533 3300048912 Bacteria 1485
165 Ga0496112_0640436 3300048915 Bacteria 993
166 Ga0496114_0631833 3300048917 Bacteria 943
167 Ga0496115_0105229 3300048918 Unclassified 2316
168 Ga0501032_0243282 3300049569 Bacteria 1169
169 Ga0501047_0239266 3300049581 Bacteria 1666
170 Ga0501071_0274321 3300049587 Unclassified 1276
171 Ga0501072_0347328 3300049588 Unclassified 1178
172 Ga0501073_0136414 3300049589 Bacteria 1701
173 Ga0501074_0350181 3300049590 Bacteria 1048
174 Ga0501075_0238944 3300049591 Bacteria 1385
175 Ga0501076_0111391 3300049592 Bacteria 2212
176 Ga0501081_0013634 3300049743 Bacteria 5343
177 Ga0501035_0359188 3300049822 Bacteria 1218
178 Ga0501044_0098584 3300049823 Bacteria 2942
179 nmdc:mga05p37_132546_c1 3300050507 Unclassified 3057
180 nmdc:mga05p37_15_c1 3300050507 Bacteria 134650
181 nmdc:mga09592_53553_c1 3300050508 Bacteria 3407
182 nmdc:mga08y16_512588_c1 3300050511 Unclassified 1217
183 nmdc:mga0n895_235461_c1 3300050512 Bacteria 1858
184 nmdc:mga0rr50_401186_c2 3300050513 Bacteria 805
185 nmdc:mga0a205_106145_c1 3300050515 Bacteria 2707
186 nmdc:mga0a205_310710_c1 3300050515 Unclassified 1448
187 nmdc:mga0a205_385021_c1 3300050515 Bacteria 1267
188 Ga0495601_0086203 3300053077 Unclassified 2018
189 Ga0495595_0043337 3300053084 Unclassified 2064
190 Ga0495595_0155180 3300053084 Bacteria 1128
191 Ga0065712_10109792
192 JGI24751J29686_10027451
193 Ga0065707_10294224
194 Ga0065707_10303088
195 Ga0070676_10135928
196 Ga0070683_100292159
197 Ga0070670_100161380
198 Ga0070670_100181571
199 Ga0070677_10008512
200 Ga0070682_100144159
201 Ga0070660_100011243
202 Ga0070671_100533858
203 Ga0070673_100020301
204 Ga0070659_100191777
205 Ga0070705_100162832
206 Ga0070694_100011143
207 Ga0070681_10005459
208 Ga0070681_10213252
209 Ga0068867_100500263
210 Ga0070707_100109655
211 Ga0070707_100290691
212 Ga0070707_100304877
213 Ga0070698_100038417
214 Ga0070679_100101679
215 Ga0070679_100126915
216 Ga0070695_100004568
217 Ga0070695_100083106
218 Ga0070665_100001812
219 Ga0070665_100184718
220 Ga0070704_100011841
221 Ga0068859_100003822
222 Ga0068859_100009861
223 Ga0068859_100072615
224 Ga0068859_100209205
225 Ga0068864_100002710
226 Ga0068864_100015556
227 Ga0068866_10099272
228 Ga0068863_100416956
229 Ga0068858_100010011
230 Ga0068858_100016758
231 Ga0068858_100672345
232 Ga0068858_100756745
233 Ga0068860_100019956
234 Ga0070715_10071946
235 Ga0097621_100028727
236 Ga0097621_100048417
237 Ga0097621_100164706
238 Ga0068871_100106083
239 Ga0068871_100129524
240 Ga0068871_100394866
241 Ga0075431_100615634
242 Ga0075433_10062578
243 Ga0075433_10116045
244 Ga0075433_10401248
245 Ga0075434_100319606
246 Ga0075429_100161091
247 Ga0068865_100329131
248 Ga0097620_100003822
249 Ga0097620_100009861
250 Ga0097620_100072615
251 Ga0097620_100209207
252 Ga0075435_100057838
253 Ga0111539_10004260
254 Ga0111539_10017055
255 Ga0111539_10818370
256 Ga0105245_10005879
257 Ga0105245_10414312
258 Ga0105247_10061732
259 Ga0114129_10001471
260 Ga0114129_10163817
261 Ga0114129_10221419
262 Ga0114129_10693874
263 Ga0105248_10032828
264 Ga0105248_10082957
265 Ga0105248_10124948
266 Ga0105248_10236028
267 Ga0105248_10489647
268 Ga0105248_10551437
269 Ga0105237_10309124
270 Ga0105249_10367163
271 Ga0157378_10132691
272 Ga0163162_10613216
273 Ga0157375_10413450
274 Ga0163163_10003744
275 Ga0163163_10021922
276 Ga0163163_10064081
277 Ga0157380_10123988
278 Ga0157380_10864043
279 Ga0157379_10012931
280 Ga0157379_10111512
281 Ga0157376_10550807
282 Ga0207710_10065800
283 Ga0207707_10022097
284 Ga0207707_10092107
285 Ga0207660_10099307
286 Ga0207652_10090407
287 Ga0207646_10048167
288 Ga0207646_10056147
289 Ga0207650_10116880
290 Ga0207687_10046255
291 Ga0207644_10340549
292 Ga0207686_10071025
293 Ga0207669_10484891
294 Ga0207691_10071568
295 Ga0207711_10052651
296 Ga0207711_10089317
297 Ga0207711_10115621
298 Ga0207711_10157319
299 Ga0207711_10186967
300 Ga0207711_10228051
301 Ga0207689_10233942
302 Ga0207679_10073326
303 Ga0207679_10519315
304 Ga0207651_10005050
305 Ga0207640_10078547
306 Ga0207658_10394580
307 Ga0207677_10011299
308 Ga0207703_10032732
309 Ga0207703_10037221
310 Ga0207703_10721487
311 Ga0207641_10236265
312 Ga0207676_10489325
313 Ga0207675_100561539
314 Ga0207683_10216001
315 Ga0207428_10027266
316 Ga0268266_10243720
317 Ga0268266_10379934
318 Ga0268265_10420854
319 Ga0268264_10166298
320 Ga0268264_10590062
321 Ga0268264_10680662
322 Ga0265334_10021704
323 Ga0307408_100149579
324 Ga0265314_10012086
325 Ga0307413_10062110
326 Ga0373955_0112357
327 Ga0373933_0076745
328 Ga0373937_0056255
329 Ga0373937_0086309
330 Ga0373937_0103061
331 Ga0373937_0530236
332 Ga0373937_0583511
333 Ga0373925_0572128
334 Ga0466967_0859036
335 Ga0495628_0056903
336 Ga0495628_0094097
337 Ga0495628_0274664
338 Ga0495652_0212601
339 Ga0495586_0049741
340 Ga0495621_0023634
341 Ga0495667_0004006
342 Ga0495634_0143078
343 Ga0495635_0057662
344 Ga0495599_0185455
345 Ga0495658_0212380
346 Ga0495613_0230210
347 Ga0495674_0473234
348 Ga0495684_0082036
349 Ga0496101_0141107
350 Ga0496104_0182808
351 Ga0496106_0050748
352 Ga0496107_0280788
353 Ga0496108_0344608
354 Ga0496109_0311533
355 Ga0496112_0640436
356 Ga0496114_0631833
357 Ga0496115_0105229
358 Ga0501032_0243282
359 Ga0501047_0239266
360 Ga0501071_0274321
361 Ga0501072_0347328
362 Ga0501073_0136414
363 Ga0501074_0350181
364 Ga0501075_0238944
365 Ga0501076_0111391
366 Ga0501081_0013634
367 Ga0501035_0359188
368 Ga0501044_0098584
369 nmdc:mga05p37_132546_c1
370 nmdc:mga05p37_15_c1
371 nmdc:mga09592_53553_c1
372 nmdc:mga08y16_512588_c1
373 nmdc:mga0n895_235461_c1
374 nmdc:mga0rr50_401186_c2
375 nmdc:mga0a205_106145_c1
376 nmdc:mga0a205_310710_c1
377 nmdc:mga0a205_385021_c1
378 Ga0495601_0086203
379 Ga0495595_0043337
380 Ga0495595_0155180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

61

285

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7861 33 248
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7754 33 248
3qgm-assembly1.cif.gz_A p-nitrophenyl phosphatase from archaeoglobus fulgidus 0.6587 82 128
8ctq-assembly1.cif.gz_A crystal structure of engineered phospholipase d mutant superpld 2-48 0.5834 92 156
8ctp-assembly1.cif.gz_A crystal structure of engineered phospholipase d mutant superpld 2-23 0.5824 92 156
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7674 33 248 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7575 33 248 3.40.50.12140
5dncD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6846 97 127 3.40.50.40
af_Q9LTI3_29_113_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6732 216 248 1.20.1280.290
1djoB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6295 95 130 3.40.50.40
ID Description Score Start End GO Terms
AF-A0A1Q7AMC7-F1-model_v4 DUF4159 domain-containing protein 0.9697 37 250
AF-A0A2W4RZJ7-F1-model_v4 DUF4159 domain-containing protein 0.9661 25 250
AF-A0A7V8WDT2-F1-model_v4 DUF4159 domain-containing protein 0.9645 55 250
AF-A0A2V8F354-F1-model_v4 DUF4159 domain-containing protein 0.9636 23 250
AF-A0A2V8ETQ9-F1-model_v4 DUF4159 domain-containing protein 0.9636 19 130

Map