F293184

General Info

Members Datasets Scaffolds Average Seq Length
190 132 380 213

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_219140_c1|nmdc:mga03683_219140_c1_74_841
Length 255
Sequence MAKTSKPRTMPVFQFRPHPWHGLDAGPEPPGHLNAFIEITPFDLMKYEVDKVSGYLHVDRPQRFSAQHPALYGFVPRTYCAERVRKLAPGSKRGDGDPLDICVFSERSITRNEIIVRCNVIGGLQMIDRGEADDKIIAVLDNDHMWKSAKDISDVPPVLIERLQHYFLTYKLVPGQKAVAKIGKILWPRTRTQSGEGGHGGLRGGVPGAGLAVRLATAASSARLPSPWIARPTGCCSSRSCPRGTRTRRPSRRSW

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 1.58
Rhizosphere 95.26
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_219140_c1 3300050489 Bacteria 877
2 MBSR1b_contig_3864925 2162886012 Bacteria 971
3 Ga0065712_10242422 3300005290 Unclassified 980
4 Ga0070690_100223710 3300005330 Bacteria 1320
5 Ga0070680_100501920 3300005336 Bacteria 1038
6 Ga0070691_10003366 3300005341 Bacteria 7183
7 Ga0070674_100125551 3300005356 Bacteria 1905
8 Ga0070673_100186718 3300005364 Bacteria 1778
9 Ga0070688_100384621 3300005365 Bacteria 1035
10 Ga0070701_10002422 3300005438 Bacteria 7189
11 Ga0070711_100101874 3300005439 Bacteria 2090
12 Ga0070705_100007172 3300005440 Bacteria 5486
13 Ga0070705_100216036 3300005440 Bacteria 1325
14 Ga0070700_100000868 3300005441 Bacteria 14903
15 Ga0070694_100086725 3300005444 Bacteria 2188
16 Ga0070694_100144602 3300005444 Bacteria 1731
17 Ga0070694_100348770 3300005444 Unclassified 1146
18 Ga0070708_100119520 3300005445 Bacteria 2429
19 Ga0070708_101001111 3300005445 Unclassified 784
20 Ga0070707_100025411 3300005468 Bacteria 5618
21 Ga0070699_100072424 3300005518 Bacteria 2997
22 Ga0070699_100160098 3300005518 Bacteria 1992
23 Ga0070672_100213997 3300005543 Bacteria 1615
24 Ga0070672_100486585 3300005543 Bacteria 1066
25 Ga0070695_100012440 3300005545 Bacteria 5107
26 Ga0070695_100028608 3300005545 Bacteria 3459
27 Ga0070695_100295778 3300005545 Bacteria 1195
28 Ga0070695_100383734 3300005545 Bacteria 1061
29 Ga0070696_100102923 3300005546 Bacteria 2048
30 Ga0070704_100297178 3300005549 Bacteria 1344
31 Ga0070704_100301634 3300005549 Bacteria 1335
32 Ga0070702_100006310 3300005615 Bacteria 5602
33 Ga0068852_100170080 3300005616 Bacteria 2042
34 Ga0068859_100089499 3300005617 Bacteria 3128
35 Ga0068859_100425921 3300005617 Bacteria 1423
36 Ga0068864_101230082 3300005618 Unclassified 748
37 Ga0068861_100008110 3300005719 Bacteria 7225
38 Ga0068858_100123777 3300005842 Bacteria 2420
39 Ga0068862_100220941 3300005844 Bacteria 1715
40 Ga0075366_10352020 3300006195 Bacteria 904
41 Ga0068871_100529280 3300006358 Unclassified 1065
42 Ga0068871_100559492 3300006358 Bacteria 1037
43 Ga0075428_100031332 3300006844 Bacteria 5880
44 Ga0075431_100038955 3300006847 Bacteria 4897
45 Ga0075431_100645153 3300006847 Bacteria 1040
46 Ga0075433_10366906 3300006852 Bacteria 1271
47 Ga0075434_100855772 3300006871 Bacteria 925
48 Ga0075429_100005501 3300006880 Bacteria 10908
49 Ga0075429_100079382 3300006880 Bacteria 2861
50 Ga0097620_100089497 3300006931 Bacteria 3128
51 Ga0097620_100425935 3300006931 Bacteria 1423
52 Ga0075435_100086586 3300007076 Bacteria 2580
53 Ga0105240_10040147 3300009093 Bacteria 5990
54 Ga0111539_10009320 3300009094 Bacteria 12399
55 Ga0111539_10024236 3300009094 Bacteria 7451
56 Ga0111539_10065416 3300009094 Bacteria 4296
57 Ga0111539_10925819 3300009094 Bacteria 1014
58 Ga0111539_11052593 3300009094 Bacteria 946
59 Ga0111539_11133821 3300009094 Bacteria 909
60 Ga0114129_10006963 3300009147 Bacteria 16086
61 Ga0114129_10011069 3300009147 Bacteria 12851
62 Ga0114129_10174235 3300009147 Unclassified 2931
63 Ga0105243_10010133 3300009148 Bacteria 7167
64 Ga0105241_10177984 3300009174 Bacteria 1762
65 Ga0105248_10167187 3300009177 Bacteria 2479
66 Ga0105248_10177962 3300009177 Bacteria 2397
67 Ga0105248_10676380 3300009177 Bacteria 1164
68 Ga0105248_10678627 3300009177 Bacteria 1162
69 Ga0105237_10144085 3300009545 Bacteria 2377
70 Ga0105249_10381454 3300009553 Bacteria 1436
71 Ga0105249_10543107 3300009553 Bacteria 1212
72 Ga0157369_10017102 3300013105 Bacteria 8148
73 Ga0157378_10084889 3300013297 Bacteria 2868
74 Ga0163162_10009992 3300013306 Bacteria 9230
75 Ga0163162_10459526 3300013306 Bacteria 1405
76 Ga0157372_10103923 3300013307 Bacteria 3247
77 Ga0157375_10359058 3300013308 Bacteria 1623
78 Ga0157375_11282622 3300013308 Bacteria 861
79 Ga0163163_10008522 3300014325 Bacteria 9111
80 Ga0157380_10007183 3300014326 Bacteria 7894
81 Ga0157380_10589130 3300014326 Bacteria 1098
82 Ga0157380_10827780 3300014326 Bacteria 945
83 Ga0157380_11171368 3300014326 Bacteria 811
84 Ga0157379_10042479 3300014968 Unclassified 4059
85 Ga0157376_10124555 3300014969 Bacteria 2289
86 Ga0206356_10390194 3300020070 Bacteria 2782
87 Ga0207642_10227190 3300025899 Bacteria 1046
88 Ga0207699_10004324 3300025906 Bacteria 6796
89 Ga0207645_10006153 3300025907 Bacteria 8621
90 Ga0207684_10044531 3300025910 Bacteria 3764
91 Ga0207695_10079792 3300025913 Bacteria 3315
92 Ga0207671_10100097 3300025914 Bacteria 2194
93 Ga0207663_10031756 3300025916 Bacteria 3129
94 Ga0207681_10126004 3300025923 Bacteria 1886
95 Ga0207669_10089799 3300025937 Bacteria 1996
96 Ga0207669_10098327 3300025937 Bacteria 1927
97 Ga0207691_10530321 3300025940 Bacteria 999
98 Ga0207711_10245450 3300025941 Bacteria 1643
99 Ga0207667_10208062 3300025949 Bacteria 2006
100 Ga0207651_10160384 3300025960 Bacteria 1762
101 Ga0207640_10343431 3300025981 Bacteria 1197
102 Ga0207703_10601940 3300026035 Bacteria 1040
103 Ga0207708_10003594 3300026075 Bacteria 11427
104 Ga0207641_10035018 3300026088 Bacteria 4180
105 Ga0207648_10010620 3300026089 Bacteria 8706
106 Ga0207675_100006347 3300026118 Bacteria 11209
107 Ga0207428_10001467 3300027907 Bacteria 24687
108 Ga0207428_10007177 3300027907 Bacteria 10187
109 Ga0207428_10062545 3300027907 Bacteria 2943
110 Ga0207428_10318333 3300027907 Unclassified 1149
111 Ga0207428_10567562 3300027907 Unclassified 820
112 Ga0268264_10225389 3300028381 Bacteria 1728
113 Ga0307408_100479483 3300031548 Bacteria 1085
114 Ga0307405_10010018 3300031731 Bacteria 4889
115 Ga0307413_10003439 3300031824 Bacteria 6661
116 Ga0307413_10306336 3300031824 Bacteria 1207
117 Ga0307410_10000771 3300031852 Bacteria 13502
118 Ga0307407_10006458 3300031903 Bacteria 5213
119 Ga0307409_100024921 3300031995 Bacteria 4184
120 Ga0307409_100099741 3300031995 Bacteria 2406
121 Ga0307409_100103312 3300031995 Bacteria 2370
122 Ga0307416_100001235 3300032002 Bacteria 13784
123 Ga0307416_100176793 3300032002 Bacteria 1995
124 Ga0307416_100774337 3300032002 Bacteria 1054
125 Ga0307416_101087481 3300032002 Bacteria 904
126 Ga0307414_10036325 3300032004 Bacteria 3289
127 Ga0307411_10179571 3300032005 Bacteria 1605
128 Ga0373933_0240984 3300035724 Bacteria 1163
129 Ga0373925_0063179 3300037068 Bacteria 2786
130 Ga0395900_0316646 3300037418 Bacteria 1542
131 Ga0395900_0317570 3300037418 Bacteria 1539
132 Ga0395898_0036947 3300037466 Bacteria 4848
133 Ga0439439_0069786 3300041406 Bacteria 940
134 Ga0451807_0595535 3300041486 Bacteria 982
135 Ga0451807_2264735 3300041486 Bacteria 1303
136 Ga0451839_1594388 3300041496 Bacteria 832
137 Ga0439462_0014417 3300042015 Bacteria 2031
138 Ga0439446_0087337 3300042156 Bacteria 972
139 Ga0439434_0069796 3300042435 Bacteria 1105
140 Ga0439435_0058350 3300042436 Bacteria 1120
141 Ga0466959_0066709 3300045049 Bacteria 2610
142 Ga0495592_0041506 3300046454 Bacteria 3448
143 Ga0495651_0380870 3300046462 Bacteria 925
144 Ga0495594_0227703 3300046499 Bacteria 1063
145 Ga0495621_0201644 3300046539 Unclassified 800
146 Ga0495635_0334952 3300046663 Bacteria 1011
147 Ga0495599_0030954 3300046678 Bacteria 3359
148 Ga0496112_0725360 3300048915 Bacteria 921
149 Ga0501036_0165178 3300049572 Bacteria 1866
150 Ga0501041_0051606 3300049577 Bacteria 2507
151 Ga0501046_0355653 3300049580 Bacteria 1063
152 Ga0501047_0157060 3300049581 Bacteria 2148
153 Ga0501048_0499488 3300049582 Bacteria 872
154 Ga0501071_0364832 3300049587 Bacteria 1100
155 Ga0501072_0584283 3300049588 Bacteria 881
156 Ga0501072_0648079 3300049588 Bacteria 831
157 Ga0501073_0001919 3300049589 Bacteria 15478
158 Ga0501073_0466443 3300049589 Bacteria 873
159 Ga0501074_0009835 3300049590 Bacteria 6946
160 Ga0501074_0037514 3300049590 Bacteria 3513
161 Ga0501075_0181758 3300049591 Bacteria 1604
162 Ga0501076_0037666 3300049592 Bacteria 3794
163 Ga0501076_0156122 3300049592 Bacteria 1858
164 Ga0501209_043045 3300049656 Bacteria 1202
165 Ga0501079_0116386 3300049741 Bacteria 2078
166 Ga0501079_0275793 3300049741 Bacteria 1315
167 Ga0501080_0486315 3300049742 Bacteria 1104
168 Ga0501081_0448158 3300049743 Bacteria 959
169 Ga0501083_0083102 3300049744 Unclassified 2121
170 nmdc:mga0k408_311075_c1 3300050493 Bacteria 940
171 nmdc:mga06z11_279073_c1 3300050494 Unclassified 989
172 nmdc:mga05p37_242017_c1 3300050507 Bacteria 2169
173 nmdc:mga05p37_7990_c1 3300050507 Bacteria 12487
174 nmdc:mga09592_1162_c1 3300050508 Bacteria 21013
175 nmdc:mga0qj67_176019_c1 3300050509 Bacteria 1737
176 nmdc:mga06r32_1080888_c1 3300050510 Bacteria 752
177 nmdc:mga06r32_221765_c1 3300050510 Bacteria 1879
178 nmdc:mga08y16_18719_c1 3300050511 Bacteria 7294
179 nmdc:mga08y16_2177_c1 3300050511 Bacteria 20094
180 nmdc:mga08y16_24223_c1 3300050511 Bacteria 6407
181 nmdc:mga08y16_629242_c1 3300050511 Bacteria 1079
182 nmdc:mga08y16_71625_c1 3300050511 Bacteria 3612
183 nmdc:mga08y16_974170_c1 3300050511 Bacteria 830
184 Ga0495612_0113178 3300053078 Bacteria 1163
185 Ga0495595_0073362 3300053084 Bacteria 1621
186 Ga0500646_0052356 3300053090 Bacteria 1181
187 Ga0501084_0002203 3300054114 Bacteria 15624
188 Ga0501084_0122286 3300054114 Bacteria 2189
189 Ga0501084_0125507 3300054114 Bacteria 2160
190 Ga0501082_0537470 3300060353 Bacteria 1022
191 nmdc:mga03683_219140_c1
192 MBSR1b_contig_3864925
193 Ga0065712_10242422
194 Ga0070690_100223710
195 Ga0070680_100501920
196 Ga0070691_10003366
197 Ga0070674_100125551
198 Ga0070673_100186718
199 Ga0070688_100384621
200 Ga0070701_10002422
201 Ga0070711_100101874
202 Ga0070705_100007172
203 Ga0070705_100216036
204 Ga0070700_100000868
205 Ga0070694_100086725
206 Ga0070694_100144602
207 Ga0070694_100348770
208 Ga0070708_100119520
209 Ga0070708_101001111
210 Ga0070707_100025411
211 Ga0070699_100072424
212 Ga0070699_100160098
213 Ga0070672_100213997
214 Ga0070672_100486585
215 Ga0070695_100012440
216 Ga0070695_100028608
217 Ga0070695_100295778
218 Ga0070695_100383734
219 Ga0070696_100102923
220 Ga0070704_100297178
221 Ga0070704_100301634
222 Ga0070702_100006310
223 Ga0068852_100170080
224 Ga0068859_100089499
225 Ga0068859_100425921
226 Ga0068864_101230082
227 Ga0068861_100008110
228 Ga0068858_100123777
229 Ga0068862_100220941
230 Ga0075366_10352020
231 Ga0068871_100529280
232 Ga0068871_100559492
233 Ga0075428_100031332
234 Ga0075431_100038955
235 Ga0075431_100645153
236 Ga0075433_10366906
237 Ga0075434_100855772
238 Ga0075429_100005501
239 Ga0075429_100079382
240 Ga0097620_100089497
241 Ga0097620_100425935
242 Ga0075435_100086586
243 Ga0105240_10040147
244 Ga0111539_10009320
245 Ga0111539_10024236
246 Ga0111539_10065416
247 Ga0111539_10925819
248 Ga0111539_11052593
249 Ga0111539_11133821
250 Ga0114129_10006963
251 Ga0114129_10011069
252 Ga0114129_10174235
253 Ga0105243_10010133
254 Ga0105241_10177984
255 Ga0105248_10167187
256 Ga0105248_10177962
257 Ga0105248_10676380
258 Ga0105248_10678627
259 Ga0105237_10144085
260 Ga0105249_10381454
261 Ga0105249_10543107
262 Ga0157369_10017102
263 Ga0157378_10084889
264 Ga0163162_10009992
265 Ga0163162_10459526
266 Ga0157372_10103923
267 Ga0157375_10359058
268 Ga0157375_11282622
269 Ga0163163_10008522
270 Ga0157380_10007183
271 Ga0157380_10589130
272 Ga0157380_10827780
273 Ga0157380_11171368
274 Ga0157379_10042479
275 Ga0157376_10124555
276 Ga0206356_10390194
277 Ga0207642_10227190
278 Ga0207699_10004324
279 Ga0207645_10006153
280 Ga0207684_10044531
281 Ga0207695_10079792
282 Ga0207671_10100097
283 Ga0207663_10031756
284 Ga0207681_10126004
285 Ga0207669_10089799
286 Ga0207669_10098327
287 Ga0207691_10530321
288 Ga0207711_10245450
289 Ga0207667_10208062
290 Ga0207651_10160384
291 Ga0207640_10343431
292 Ga0207703_10601940
293 Ga0207708_10003594
294 Ga0207641_10035018
295 Ga0207648_10010620
296 Ga0207675_100006347
297 Ga0207428_10001467
298 Ga0207428_10007177
299 Ga0207428_10062545
300 Ga0207428_10318333
301 Ga0207428_10567562
302 Ga0268264_10225389
303 Ga0307408_100479483
304 Ga0307405_10010018
305 Ga0307413_10003439
306 Ga0307413_10306336
307 Ga0307410_10000771
308 Ga0307407_10006458
309 Ga0307409_100024921
310 Ga0307409_100099741
311 Ga0307409_100103312
312 Ga0307416_100001235
313 Ga0307416_100176793
314 Ga0307416_100774337
315 Ga0307416_101087481
316 Ga0307414_10036325
317 Ga0307411_10179571
318 Ga0373933_0240984
319 Ga0373925_0063179
320 Ga0395900_0316646
321 Ga0395900_0317570
322 Ga0395898_0036947
323 Ga0439439_0069786
324 Ga0451807_0595535
325 Ga0451807_2264735
326 Ga0451839_1594388
327 Ga0439462_0014417
328 Ga0439446_0087337
329 Ga0439434_0069796
330 Ga0439435_0058350
331 Ga0466959_0066709
332 Ga0495592_0041506
333 Ga0495651_0380870
334 Ga0495594_0227703
335 Ga0495621_0201644
336 Ga0495635_0334952
337 Ga0495599_0030954
338 Ga0496112_0725360
339 Ga0501036_0165178
340 Ga0501041_0051606
341 Ga0501046_0355653
342 Ga0501047_0157060
343 Ga0501048_0499488
344 Ga0501071_0364832
345 Ga0501072_0584283
346 Ga0501072_0648079
347 Ga0501073_0001919
348 Ga0501073_0466443
349 Ga0501074_0009835
350 Ga0501074_0037514
351 Ga0501075_0181758
352 Ga0501076_0037666
353 Ga0501076_0156122
354 Ga0501209_043045
355 Ga0501079_0116386
356 Ga0501079_0275793
357 Ga0501080_0486315
358 Ga0501081_0448158
359 Ga0501083_0083102
360 nmdc:mga0k408_311075_c1
361 nmdc:mga06z11_279073_c1
362 nmdc:mga05p37_242017_c1
363 nmdc:mga05p37_7990_c1
364 nmdc:mga09592_1162_c1
365 nmdc:mga0qj67_176019_c1
366 nmdc:mga06r32_1080888_c1
367 nmdc:mga06r32_221765_c1
368 nmdc:mga08y16_18719_c1
369 nmdc:mga08y16_2177_c1
370 nmdc:mga08y16_24223_c1
371 nmdc:mga08y16_629242_c1
372 nmdc:mga08y16_71625_c1
373 nmdc:mga08y16_974170_c1
374 Ga0495612_0113178
375 Ga0495595_0073362
376 Ga0500646_0052356
377 Ga0501084_0002203
378 Ga0501084_0122286
379 Ga0501084_0125507
380 Ga0501082_0537470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

35

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q5v-assembly1.cif.gz_A the structure of inorganic pyrophosphatase from thermococcus thioreducens in complex with magnesium and sulfate 0.7918 10 200
3r6e-assembly1.cif.gz_D the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate 0.7915 10 197
6we5-assembly1.cif.gz_C crystal structure of an inorganic pyrophosphatase from chlamydia trachomatis d/uw-3/cx 0.7909 9 197
3r6e-assembly1.cif.gz_B the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate 0.7899 10 197
3r6e-assembly1.cif.gz_E the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate 0.7885 10 197
ID Description Score Start End Superfamily
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7918 10 197 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7709 10 197 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7693 23 196 3.90.80.10
af_A0A0R0EZ04_29_196_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7582 9 190 3.90.80.10
af_Q91VM9_27_330_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7522 10 194 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A3C0MH07-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9677 113 198 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A7V3MX96-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9526 86 196 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3A0FEW2-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9512 107 197 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A357F3R9-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9457 63 182 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A356R824-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9447 62 197 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Map