F293144

General Info

Members Datasets Scaffolds Average Seq Length
190 133 380 173

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0294518|Ga0501041_0294518_171_788
Length 205
Sequence MGIWIAKPYMRMFGEQILPHFMSSRPGFSIGGCMANLSYLSPKTEVRESPIHGKGLFAIAPIPKDEIVCVKGGYIFNRQTLNGVAPSLGPAEIQIGDDLFIGPLRKEDRDGSMIFSNHSCDPNIGVQGQIIFVALRDIRPGEELTHDWATTDDDDYEMICRCGAANCRGVITGQDWRKLELQEKYRGYISWYLVEKMRRAAANAT

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 4.21
Rhizosphere 95.26
Stem 0
Stem Tuber 0
Unclassified 28.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0294518 3300049577 Bacteria 1022
2 MBSR1b_contig_11783480 2162886012 Bacteria 1285
3 JGI24746J21847_1009105 3300001977 Bacteria 1489
4 Ga0065704_10347037 3300005289 Unclassified 815
5 Ga0065712_10014161 3300005290 Unclassified 1759
6 Ga0065715_10124987 3300005293 Bacteria 2141
7 Ga0065715_10127390 3300005293 Unclassified 2088
8 Ga0065715_10244811 3300005293 Bacteria 1187
9 Ga0065715_10397434 3300005293 Bacteria 826
10 Ga0065715_10435153 3300005293 Bacteria 842
11 Ga0070676_10000248 3300005328 Bacteria 23423
12 Ga0070683_100654005 3300005329 Bacteria 1006
13 Ga0068869_100078625 3300005334 Bacteria 2457
14 Ga0068868_100006364 3300005338 Bacteria 8353
15 Ga0070660_100278881 3300005339 Bacteria 1367
16 Ga0070689_100007599 3300005340 Bacteria 7593
17 Ga0070669_100000734 3300005353 Bacteria 23917
18 Ga0070675_100004509 3300005354 Bacteria 10639
19 Ga0070675_100266750 3300005354 Bacteria 1501
20 Ga0070673_100025768 3300005364 Bacteria 4333
21 Ga0070667_100008341 3300005367 Bacteria 8587
22 Ga0070667_100336178 3300005367 Unclassified 1365
23 Ga0070714_100382738 3300005435 Unclassified 1327
24 Ga0070713_100201060 3300005436 Bacteria 1800
25 Ga0070713_100632689 3300005436 Bacteria 1018
26 Ga0070710_10548927 3300005437 Unclassified 798
27 Ga0070710_10651176 3300005437 Bacteria 738
28 Ga0070708_100484771 3300005445 Bacteria 1166
29 Ga0070708_100816164 3300005445 Bacteria 877
30 Ga0070662_100001586 3300005457 Bacteria 14046
31 Ga0068867_101165538 3300005459 Unclassified 706
32 Ga0070685_10071584 3300005466 Unclassified 2056
33 Ga0070706_100171665 3300005467 Bacteria 2025
34 Ga0070706_100258841 3300005467 Bacteria 1624
35 Ga0070706_100662818 3300005467 Unclassified 968
36 Ga0070707_100275540 3300005468 Bacteria 1635
37 Ga0070707_100608256 3300005468 Unclassified 1055
38 Ga0070698_100318473 3300005471 Unclassified 1486
39 Ga0070698_100869724 3300005471 Bacteria 846
40 Ga0070699_100044095 3300005518 Bacteria 3861
41 Ga0070699_100078494 3300005518 Bacteria 2875
42 Ga0070684_100342544 3300005535 Unclassified 1374
43 Ga0070697_100067941 3300005536 Unclassified 2917
44 Ga0070697_100192175 3300005536 Bacteria 1733
45 Ga0070697_101550666 3300005536 Unclassified 592
46 Ga0070695_100672797 3300005545 Bacteria 819
47 Ga0068852_100242223 3300005616 Bacteria 1724
48 Ga0068858_100533823 3300005842 Bacteria 1135
49 Ga0068860_100019432 3300005843 Bacteria 6589
50 Ga0068862_100006381 3300005844 Bacteria 9803
51 Ga0068862_100977818 3300005844 Bacteria 836
52 Ga0081455_10010889 3300005937 Bacteria 9178
53 Ga0081455_10083698 3300005937 Bacteria 2606
54 Ga0081455_10161854 3300005937 Bacteria 1714
55 Ga0081455_10241825 3300005937 Bacteria 1326
56 Ga0081538_10022142 3300005981 Unclassified 4616
57 Ga0081539_10000939 3300005985 Bacteria 54579
58 Ga0070717_10044177 3300006028 Bacteria 3638
59 Ga0070717_10045447 3300006028 Bacteria 3590
60 Ga0070717_10078871 3300006028 Bacteria 2760
61 Ga0070717_10551472 3300006028 Bacteria 1044
62 Ga0070715_10000006 3300006163 Bacteria 216296
63 Ga0070716_100449472 3300006173 Bacteria 939
64 Ga0097621_100048066 3300006237 Bacteria 3460
65 Ga0075428_100819566 3300006844 Bacteria 989
66 Ga0075428_100851891 3300006844 Unclassified 968
67 Ga0075428_100999533 3300006844 Bacteria 886
68 Ga0075433_10409299 3300006852 Unclassified 1196
69 Ga0075434_100131112 3300006871 Unclassified 2525
70 Ga0075434_100858400 3300006871 Unclassified 923
71 Ga0075429_100103494 3300006880 Bacteria 2486
72 Ga0075429_100330136 3300006880 Unclassified 1335
73 Ga0111539_10000340 3300009094 Bacteria 57536
74 Ga0111539_10075362 3300009094 Bacteria 3974
75 Ga0111539_10221861 3300009094 Bacteria 2201
76 Ga0111539_10243706 3300009094 Unclassified 2093
77 Ga0105245_10136753 3300009098 Bacteria 2304
78 Ga0114129_10099124 3300009147 Unclassified 4033
79 Ga0114129_10276747 3300009147 Bacteria 2244
80 Ga0114129_10316397 3300009147 Bacteria 2076
81 Ga0114129_10351020 3300009147 Bacteria 1954
82 Ga0105243_10136639 3300009148 Bacteria 2086
83 Ga0105237_10051331 3300009545 Bacteria 4142
84 Ga0105237_10766415 3300009545 Bacteria 972
85 Ga0105249_10002500 3300009553 Bacteria 15914
86 Ga0105249_10488314 3300009553 Bacteria 1275
87 Ga0099796_10040760 3300010159 Bacteria 1569
88 Ga0105239_10015469 3300010375 Bacteria 8452
89 Ga0105239_10467969 3300010375 Bacteria 1431
90 Ga0105246_10077158 3300011119 Bacteria 2363
91 Ga0157371_10201718 3300013102 Bacteria 1426
92 Ga0157374_10015164 3300013296 Bacteria 6758
93 Ga0157378_10003931 3300013297 Bacteria 13148
94 Ga0157378_11019064 3300013297 Unclassified 863
95 Ga0163162_10002397 3300013306 Bacteria 17627
96 Ga0157375_10627244 3300013308 Unclassified 1233
97 Ga0157375_10652555 3300013308 Unclassified 1208
98 Ga0163163_10181937 3300014325 Bacteria 2149
99 Ga0157380_10301380 3300014326 Unclassified 1476
100 Ga0157379_10107889 3300014968 Unclassified 2500
101 Ga0163161_10242541 3300017792 Bacteria 1402
102 Ga0207666_1002248 3300025271 Bacteria 2316
103 Ga0207697_10000302 3300025315 Bacteria 27561
104 Ga0207653_10273898 3300025885 Unclassified 650
105 Ga0207682_10252146 3300025893 Bacteria 822
106 Ga0207688_10077194 3300025901 Bacteria 1898
107 Ga0207685_10000010 3300025905 Bacteria 216792
108 Ga0207645_10001125 3300025907 Bacteria 22125
109 Ga0207684_10280419 3300025910 Bacteria 1437
110 Ga0207684_10346891 3300025910 Bacteria 1278
111 Ga0207684_10473274 3300025910 Unclassified 1075
112 Ga0207684_10590765 3300025910 Unclassified 949
113 Ga0207693_10020642 3300025915 Bacteria 5238
114 Ga0207663_10269782 3300025916 Bacteria 1260
115 Ga0207662_10000375 3300025918 Bacteria 20156
116 Ga0207657_10131289 3300025919 Bacteria 2053
117 Ga0207646_10424021 3300025922 Bacteria 1201
118 Ga0207681_10002979 3300025923 Bacteria 10645
119 Ga0207659_10012109 3300025926 Bacteria 5471
120 Ga0207659_10118788 3300025926 Unclassified 2023
121 Ga0207687_10160363 3300025927 Bacteria 1725
122 Ga0207700_10463504 3300025928 Bacteria 1118
123 Ga0207664_10508318 3300025929 Bacteria 1079
124 Ga0207706_10002111 3300025933 Bacteria 19453
125 Ga0207670_10004378 3300025936 Bacteria 7593
126 Ga0207669_10781322 3300025937 Unclassified 791
127 Ga0207665_10406763 3300025939 Bacteria 1037
128 Ga0207711_10062192 3300025941 Bacteria 3220
129 Ga0207689_10028558 3300025942 Bacteria 4666
130 Ga0207651_10016520 3300025960 Bacteria 4326
131 Ga0207712_10018503 3300025961 Bacteria 4539
132 Ga0207668_10002463 3300025972 Bacteria 10811
133 Ga0207658_10004538 3300025986 Bacteria 9641
134 Ga0207677_10009748 3300026023 Bacteria 5410
135 Ga0207703_10233935 3300026035 Bacteria 1649
136 Ga0207708_10082850 3300026075 Bacteria 2466
137 Ga0207675_101242887 3300026118 Bacteria 765
138 Ga0207428_10079242 3300027907 Bacteria 2568
139 Ga0268265_10292688 3300028380 Bacteria 1462
140 Ga0268265_10325721 3300028380 Bacteria 1394
141 Ga0268264_10001797 3300028381 Bacteria 19617
142 Ga0268264_10685650 3300028381 Bacteria 1017
143 Ga0307406_10070647 3300031901 Bacteria 2287
144 Ga0316585_10162018 3300032137 Unclassified 739
145 Ga0373942_0085750 3300035207 Unclassified 942
146 Ga0373962_0205069 3300035242 Unclassified 669
147 Ga0373924_0508184 3300035410 Bacteria 542
148 Ga0373947_0886245 3300035725 Unclassified 609
149 Ga0373937_0701665 3300036401 Bacteria 958
150 Ga0316582_0372871 3300036647 Bacteria 982
151 Ga0316584_0088926 3300036712 Bacteria 2313
152 Ga0395901_0204204 3300038443 Bacteria 2071
153 Ga0436362_0064451 3300039453 Bacteria 1226
154 Ga0439464_0066445 3300042439 Unclassified 1062
155 Ga0453683_0985421 3300044673 Unclassified 559
156 Ga0451576_0048179 3300045051 Bacteria 4478
157 Ga0495623_0222978 3300046679 Unclassified 1073
158 Ga0495658_0126279 3300046683 Bacteria 1552
159 Ga0496103_0510371 3300048906 Unclassified 769
160 Ga0496104_1657120 3300048907 Unclassified 542
161 Ga0496107_0081579 3300048910 Unclassified 2359
162 Ga0496108_1162980 3300048911 Unclassified 654
163 Ga0496109_0145008 3300048912 Bacteria 2221
164 Ga0496109_0701604 3300048912 Bacteria 949
165 Ga0496110_0939477 3300048913 Bacteria 771
166 Ga0496112_0038158 3300048915 Bacteria 4691
167 Ga0501033_0744509 3300049570 Bacteria 665
168 Ga0501081_1014463 3300049743 Unclassified 627
169 Ga0501045_0501617 3300049824 Bacteria 901
170 nmdc:mga05p37_122860_c1 3300050507 Unclassified 3189
171 nmdc:mga05p37_472993_c1 3300050507 Bacteria 1445
172 nmdc:mga05p37_756803_c1 3300050507 Bacteria 1070
173 nmdc:mga05p37_951633_c1 3300050507 Unclassified 919
174 nmdc:mga09592_1155567_c1 3300050508 Unclassified 641
175 nmdc:mga0qj67_1035708_c1 3300050509 Unclassified 643
176 nmdc:mga06r32_1045961_c1 3300050510 Unclassified 767
177 nmdc:mga06r32_14864_c1 3300050510 Bacteria 7062
178 nmdc:mga06r32_368810_c1 3300050510 Unclassified 1419
179 nmdc:mga06r32_645416_c1 3300050510 Bacteria 1027
180 nmdc:mga06r32_92704_c1 3300050510 Bacteria 2954
181 nmdc:mga08y16_180557_c1 3300050511 Bacteria 2191
182 nmdc:mga08y16_367627_c1 3300050511 Bacteria 1476
183 nmdc:mga08y16_573233_c1 3300050511 Unclassified 1140
184 nmdc:mga0n895_1226853_c1 3300050512 Bacteria 723
185 nmdc:mga0n895_233036_c1 3300050512 Unclassified 1869
186 nmdc:mga0n895_824518_c1 3300050512 Bacteria 917
187 nmdc:mga0a205_33423_c1 3300050515 Bacteria 4931
188 nmdc:mga0a205_938452_c1 3300050515 Unclassified 712
189 Ga0500641_0188040 3300053096 Unclassified 885
190 Ga0530510_0106249 3300061734 Bacteria 2054
191 Ga0501041_0294518
192 MBSR1b_contig_11783480
193 JGI24746J21847_1009105
194 Ga0065704_10347037
195 Ga0065712_10014161
196 Ga0065715_10124987
197 Ga0065715_10127390
198 Ga0065715_10244811
199 Ga0065715_10397434
200 Ga0065715_10435153
201 Ga0070676_10000248
202 Ga0070683_100654005
203 Ga0068869_100078625
204 Ga0068868_100006364
205 Ga0070660_100278881
206 Ga0070689_100007599
207 Ga0070669_100000734
208 Ga0070675_100004509
209 Ga0070675_100266750
210 Ga0070673_100025768
211 Ga0070667_100008341
212 Ga0070667_100336178
213 Ga0070714_100382738
214 Ga0070713_100201060
215 Ga0070713_100632689
216 Ga0070710_10548927
217 Ga0070710_10651176
218 Ga0070708_100484771
219 Ga0070708_100816164
220 Ga0070662_100001586
221 Ga0068867_101165538
222 Ga0070685_10071584
223 Ga0070706_100171665
224 Ga0070706_100258841
225 Ga0070706_100662818
226 Ga0070707_100275540
227 Ga0070707_100608256
228 Ga0070698_100318473
229 Ga0070698_100869724
230 Ga0070699_100044095
231 Ga0070699_100078494
232 Ga0070684_100342544
233 Ga0070697_100067941
234 Ga0070697_100192175
235 Ga0070697_101550666
236 Ga0070695_100672797
237 Ga0068852_100242223
238 Ga0068858_100533823
239 Ga0068860_100019432
240 Ga0068862_100006381
241 Ga0068862_100977818
242 Ga0081455_10010889
243 Ga0081455_10083698
244 Ga0081455_10161854
245 Ga0081455_10241825
246 Ga0081538_10022142
247 Ga0081539_10000939
248 Ga0070717_10044177
249 Ga0070717_10045447
250 Ga0070717_10078871
251 Ga0070717_10551472
252 Ga0070715_10000006
253 Ga0070716_100449472
254 Ga0097621_100048066
255 Ga0075428_100819566
256 Ga0075428_100851891
257 Ga0075428_100999533
258 Ga0075433_10409299
259 Ga0075434_100131112
260 Ga0075434_100858400
261 Ga0075429_100103494
262 Ga0075429_100330136
263 Ga0111539_10000340
264 Ga0111539_10075362
265 Ga0111539_10221861
266 Ga0111539_10243706
267 Ga0105245_10136753
268 Ga0114129_10099124
269 Ga0114129_10276747
270 Ga0114129_10316397
271 Ga0114129_10351020
272 Ga0105243_10136639
273 Ga0105237_10051331
274 Ga0105237_10766415
275 Ga0105249_10002500
276 Ga0105249_10488314
277 Ga0099796_10040760
278 Ga0105239_10015469
279 Ga0105239_10467969
280 Ga0105246_10077158
281 Ga0157371_10201718
282 Ga0157374_10015164
283 Ga0157378_10003931
284 Ga0157378_11019064
285 Ga0163162_10002397
286 Ga0157375_10627244
287 Ga0157375_10652555
288 Ga0163163_10181937
289 Ga0157380_10301380
290 Ga0157379_10107889
291 Ga0163161_10242541
292 Ga0207666_1002248
293 Ga0207697_10000302
294 Ga0207653_10273898
295 Ga0207682_10252146
296 Ga0207688_10077194
297 Ga0207685_10000010
298 Ga0207645_10001125
299 Ga0207684_10280419
300 Ga0207684_10346891
301 Ga0207684_10473274
302 Ga0207684_10590765
303 Ga0207693_10020642
304 Ga0207663_10269782
305 Ga0207662_10000375
306 Ga0207657_10131289
307 Ga0207646_10424021
308 Ga0207681_10002979
309 Ga0207659_10012109
310 Ga0207659_10118788
311 Ga0207687_10160363
312 Ga0207700_10463504
313 Ga0207664_10508318
314 Ga0207706_10002111
315 Ga0207670_10004378
316 Ga0207669_10781322
317 Ga0207665_10406763
318 Ga0207711_10062192
319 Ga0207689_10028558
320 Ga0207651_10016520
321 Ga0207712_10018503
322 Ga0207668_10002463
323 Ga0207658_10004538
324 Ga0207677_10009748
325 Ga0207703_10233935
326 Ga0207708_10082850
327 Ga0207675_101242887
328 Ga0207428_10079242
329 Ga0268265_10292688
330 Ga0268265_10325721
331 Ga0268264_10001797
332 Ga0268264_10685650
333 Ga0307406_10070647
334 Ga0316585_10162018
335 Ga0373942_0085750
336 Ga0373962_0205069
337 Ga0373924_0508184
338 Ga0373947_0886245
339 Ga0373937_0701665
340 Ga0316582_0372871
341 Ga0316584_0088926
342 Ga0395901_0204204
343 Ga0436362_0064451
344 Ga0439464_0066445
345 Ga0453683_0985421
346 Ga0451576_0048179
347 Ga0495623_0222978
348 Ga0495658_0126279
349 Ga0496103_0510371
350 Ga0496104_1657120
351 Ga0496107_0081579
352 Ga0496108_1162980
353 Ga0496109_0145008
354 Ga0496109_0701604
355 Ga0496110_0939477
356 Ga0496112_0038158
357 Ga0501033_0744509
358 Ga0501081_1014463
359 Ga0501045_0501617
360 nmdc:mga05p37_122860_c1
361 nmdc:mga05p37_472993_c1
362 nmdc:mga05p37_756803_c1
363 nmdc:mga05p37_951633_c1
364 nmdc:mga09592_1155567_c1
365 nmdc:mga0qj67_1035708_c1
366 nmdc:mga06r32_1045961_c1
367 nmdc:mga06r32_14864_c1
368 nmdc:mga06r32_368810_c1
369 nmdc:mga06r32_645416_c1
370 nmdc:mga06r32_92704_c1
371 nmdc:mga08y16_180557_c1
372 nmdc:mga08y16_367627_c1
373 nmdc:mga08y16_573233_c1
374 nmdc:mga0n895_1226853_c1
375 nmdc:mga0n895_233036_c1
376 nmdc:mga0n895_824518_c1
377 nmdc:mga0a205_33423_c1
378 nmdc:mga0a205_938452_c1
379 Ga0500641_0188040
380 Ga0530510_0106249

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00856

SET

SET domain

53

149

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ynp-assembly1.cif.gz_A ash1l set domain s2259m mutant in complex with s-adenosyl methionine (sam) 0.8129 6 138
3f9z-assembly1.cif.gz_A structural insights into lysine multiple methylation by set domain methyltransferases, set8-y245f / h4-lys20 / adohcy 0.8072 6 114
4ypu-assembly1.cif.gz_A ash1l set domain k2264l mutant in complex with s-adenosyl methionine (sam) 0.802 6 138
2bqz-assembly2.cif.gz_E crystal structure of a ternary complex of the human histone methyltransferase pr-set7 (also known as set8) 0.7941 6 114
5lsu-assembly1.cif.gz_A structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives 0.7917 8 137
ID Description Score Start End Superfamily
af_A4IAN7_102_398_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.8123 4 36 3.90.1410.10
af_Q54JW6_1_189_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.8085 4 35 3.90.1410.10
af_A0A1D6EV07_1805_1959_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8075 8 139 2.170.270.10
af_E9PYH6_1484_1716_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8018 6 136 2.170.270.10
af_A0A0G2K6T6_1509_1717_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8016 6 136 2.170.270.10
ID Description Score Start End GO Terms
AF-A0A2V5MT64-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9958 1 168 GO:0005694
GO:0016279
GO:0032259
GO:0140938
AF-A0A2V6J1T1-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9952 1 167 GO:0008168
GO:0032259
AF-A0A2V5UY98-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9947 2 167 GO:0008168
GO:0032259
AF-A0A2V5KKP8-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9945 1 168 GO:0008168
GO:0032259
AF-A0A538NFZ5-F1-model_v4 SET domain-containing protein 0.993 2 169 GO:0008168
GO:0032259

Map