F293107

General Info

Members Datasets Scaffolds Average Seq Length
190 136 175 130

Family's Representative Sequence

Representative Sequence 3300049514|Ga0501291_042289|Ga0501291_042289_304_771
Length 155
Sequence VVEPVETTPGWSSLSRPPARHGTLISMTEHNVLGGELEPCGTDPVTGFYRDGSCTCGPEDIGVHAVCAVMTAEFLAHQRSVGNDLSTPMPQWGFPGLQPGDRWCVVAMRWRQAYEDGVYAPVVLASTNERALDVVPLAWLQEHSVDVPADPGDLG

Samples

Sample ID Description Type Environment
1 2527291627 Frankia casuarinae Thr Isolate Nodule
2 2527291629 Frankia sp. BMG5.23 Isolate Nodule
3 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
4 2576861822 Frankia sp. CeD Isolate Nodule
5 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
6 2619618881 Frankia sp. ACN1ag Isolate Unclassified
7 2619619003 Frankia sp. CpI1-P Isolate Nodule
8 2626541554 Frankia sp. AvcI.1 Isolate Nodule
9 2684623036 Frankia sp. CgIM4 Isolate Nodule
10 2710264753 Frankia sp. KB5 Isolate Nodule
11 2773857924 Frankia sp. CgIS1 Isolate Nodule
12 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
86 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
134 637000116 Frankia casuarinae CcI3 Isolate Nodule
135 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
136 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.47
Metatranscriptomes 2.63
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 5.79
Rhizoplane 9.47
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10126366 3300003316 Bacteria 1122
2 Ga0070658_10942107 3300005327 Bacteria 751
3 Ga0070683_100010493 3300005329 Bacteria 7967
4 Ga0070683_100016543 3300005329 Bacteria 6506
5 Ga0070683_100782924 3300005329 Bacteria 914
6 Ga0070690_100616950 3300005330 Bacteria 825
7 Ga0068869_101201089 3300005334 Bacteria 666
8 Ga0070680_100289944 3300005336 Bacteria 1387
9 Ga0070680_100374951 3300005336 Bacteria 1211
10 Ga0070691_10619059 3300005341 Bacteria 641
11 Ga0070661_100989026 3300005344 Bacteria 697
12 Ga0070668_101237503 3300005347 Bacteria 677
13 Ga0070659_100559042 3300005366 Bacteria 980
14 Ga0070659_100803312 3300005366 Bacteria 818
15 Ga0070708_100248736 3300005445 Bacteria 1670
16 Ga0070663_101690702 3300005455 Bacteria 566
17 Ga0070663_101919079 3300005455 Bacteria 532
18 Ga0070684_100534413 3300005535 Bacteria 1087
19 Ga0068855_101873387 3300005563 Bacteria 608
20 Ga0068857_100021725 3300005577 Bacteria 5648
21 Ga0068854_100148338 3300005578 Bacteria 1806
22 Ga0070702_100887323 3300005615 Bacteria 697
23 Ga0068866_10460082 3300005718 Bacteria 834
24 Ga0081538_10000308 3300005981 Bacteria 56278
25 Ga0070717_10479098 3300006028 Bacteria 1123
26 Ga0075365_10026898 3300006038 Bacteria 3655
27 Ga0075365_10081839 3300006038 Bacteria 2188
28 Ga0070715_10076565 3300006163 Bacteria 1508
29 Ga0070712_100182221 3300006175 Bacteria 1637
30 Ga0068865_100460039 3300006881 Bacteria 1054
31 Ga0111539_10304176 3300009094 Bacteria 1856
32 Ga0111539_10567098 3300009094 Bacteria 1322
33 Ga0105245_10307721 3300009098 Bacteria 1557
34 Ga0105245_12418755 3300009098 Bacteria 579
35 Ga0105237_10565107 3300009545 Bacteria 1144
36 Ga0105237_10656131 3300009545 Bacteria 1056
37 Ga0105238_11895617 3300009551 Bacteria 629
38 Ga0105239_11111814 3300010375 Bacteria 910
39 Ga0105239_11421141 3300010375 Bacteria 801
40 Ga0157369_10517854 3300013105 Bacteria 1234
41 Ga0157369_10944496 3300013105 Bacteria 884
42 Ga0163162_10248413 3300013306 Bacteria 1911
43 Ga0157372_10059918 3300013307 Bacteria 4259
44 Ga0157372_10887102 3300013307 Bacteria 1035
45 Ga0157372_11886155 3300013307 Bacteria 687
46 Ga0157380_11448850 3300014326 Bacteria 738
47 Ga0182008_10047573 3300014497 Bacteria 2131
48 Ga0182008_10058701 3300014497 Bacteria 1899
49 Ga0182008_10117686 3300014497 Bacteria 1319
50 Ga0157377_10095379 3300014745 Bacteria 1763
51 Ga0206356_10216136 3300020070 Bacteria 880
52 Ga0206354_10591087 3300020081 Bacteria 1005
53 Ga0206353_10039145 3300020082 Bacteria 713
54 Ga0206353_10739497 3300020082 Bacteria 2352
55 Ga0206353_11695621 3300020082 Bacteria 1804
56 Ga0207642_10130433 3300025899 Bacteria 1311
57 Ga0207710_10000105 3300025900 Bacteria 105872
58 Ga0207647_10270573 3300025904 Bacteria 971
59 Ga0207647_10796421 3300025904 Bacteria 508
60 Ga0207707_10668784 3300025912 Bacteria 874
61 Ga0207671_10478623 3300025914 Bacteria 992
62 Ga0207693_10814286 3300025915 Bacteria 719
63 Ga0207649_10872321 3300025920 Bacteria 705
64 Ga0207652_10558262 3300025921 Bacteria 1029
65 Ga0207700_10129835 3300025928 Bacteria 2056
66 Ga0207690_10722463 3300025932 Bacteria 820
67 Ga0207711_10024820 3300025941 Bacteria 5029
68 Ga0207689_10951009 3300025942 Bacteria 725
69 Ga0207661_10016266 3300025944 Bacteria 5487
70 Ga0207661_10212999 3300025944 Bacteria 1704
71 Ga0207702_11446229 3300026078 Bacteria 681
72 Ga0207674_10038490 3300026116 Bacteria 4962
73 Ga0207698_12075272 3300026142 Bacteria 582
74 Ga0265325_10224157 3300031241 Bacteria 859
75 Ga0265327_10322104 3300031251 Bacteria 678
76 Ga0307408_101725348 3300031548 Bacteria 597
77 Ga0265313_10065189 3300031595 Bacteria 1692
78 Ga0307410_10102810 3300031852 Bacteria 2051
79 Ga0307406_10219894 3300031901 Bacteria 1411
80 Ga0307406_10380421 3300031901 Bacteria 1113
81 Ga0307406_10808332 3300031901 Bacteria 792
82 Ga0307407_10051776 3300031903 Bacteria 2355
83 Ga0307407_10791096 3300031903 Bacteria 721
84 Ga0307412_10153960 3300031911 Bacteria 1700
85 Ga0307412_10436374 3300031911 Bacteria 1075
86 Ga0307412_10579435 3300031911 Unclassified 947
87 Ga0307409_100006548 3300031995 Bacteria 6861
88 Ga0307409_100011353 3300031995 Bacteria 5609
89 Ga0307409_100658126 3300031995 Bacteria 1042
90 Ga0307409_100756004 3300031995 Bacteria 976
91 Ga0307416_100004779 3300032002 Bacteria 8226
92 Ga0307416_100232692 3300032002 Bacteria 1778
93 Ga0307416_100403171 3300032002 Bacteria 1406
94 Ga0307416_100489940 3300032002 Bacteria 1291
95 Ga0307411_10460193 3300032005 Unclassified 1066
96 Ga0307411_10807253 3300032005 Bacteria 827
97 Ga0307415_100000214 3300032126 Bacteria 25412
98 Ga0373926_0002485 3300035083 Bacteria 5852
99 Ga0373946_0028445 3300035171 Bacteria 2218
100 Ga0373935_0000341 3300035692 Bacteria 23703
101 Ga0373947_0001989 3300035725 Bacteria 12504
102 Ga0395905_0042417 3300037471 Bacteria 4270
103 Ga0395905_0247638 3300037471 Bacteria 1665
104 Ga0395901_0014942 3300038443 Bacteria 7889
105 Ga0395901_0839937 3300038443 Bacteria 905
106 Ga0395901_2122456 3300038443 Bacteria 507
107 Ga0242420_135655 3300038996 Bacteria 545
108 Ga0451793_0485574 3300041452 Bacteria 734
109 Ga0451797_0279336 3300041453 Bacteria 771
110 Ga0451795_0002929 3300041456 Bacteria 618
111 Ga0451837_1412387 3300041494 Bacteria 777
112 Ga0451837_1519674 3300041494 Bacteria 626
113 Ga0451843_0520519 3300041509 Bacteria 1675
114 Ga0451843_0852152 3300041509 Bacteria 509
115 Ga0439457_015733 3300042014 Bacteria 1689
116 Ga0450906_021998 3300042145 Bacteria 1137
117 Ga0439446_0011114 3300042156 Bacteria 2439
118 Ga0439434_0033585 3300042435 Bacteria 1564
119 Ga0466961_0235050 3300044693 Bacteria 1127
120 Ga0466963_0182041 3300044694 Bacteria 1467
121 Ga0466963_0241314 3300044694 Bacteria 1267
122 Ga0466970_0037292 3300044765 Bacteria 2576
123 Ga0466970_0495177 3300044765 Bacteria 703
124 Ga0466960_0050388 3300044901 Bacteria 2007
125 Ga0466960_0059015 3300044901 Bacteria 1876
126 Ga0466960_0192628 3300044901 Bacteria 1110
127 Ga0466960_0434848 3300044901 Bacteria 760
128 Ga0466960_0490096 3300044901 Bacteria 719
129 Ga0466967_0042421 3300045976 Bacteria 3931
130 Ga0466967_0101387 3300045976 Bacteria 2631
131 Ga0466967_0563428 3300045976 Bacteria 1122
132 Ga0466967_0579005 3300045976 Bacteria 1106
133 Ga0466967_1051591 3300045976 Bacteria 811
134 Ga0466967_1328582 3300045976 Bacteria 716
135 Ga0495664_0036577 3300046477 Bacteria 2894
136 Ga0495608_0608086 3300046511 Bacteria 656
137 Ga0495674_0071366 3300047319 Bacteria 2998
138 Ga0495676_0556795 3300047321 Bacteria 749
139 Ga0496100_1657165 3300048903 Bacteria 506
140 Ga0496101_0061716 3300048904 Bacteria 2723
141 Ga0496102_0147744 3300048905 Bacteria 2207
142 Ga0496102_1589256 3300048905 Bacteria 572
143 Ga0496104_0850620 3300048907 Bacteria 818
144 Ga0496106_0191761 3300048909 Bacteria 1625
145 Ga0496107_0232518 3300048910 Bacteria 1372
146 Ga0496109_0408152 3300048912 Bacteria 1283
147 Ga0496109_0922663 3300048912 Bacteria 811
148 Ga0496109_1522517 3300048912 Bacteria 604
149 Ga0496111_0591892 3300048914 Bacteria 812
150 Ga0496111_0979707 3300048914 Bacteria 606
151 Ga0496115_0422513 3300048918 Bacteria 1080
152 Ga0496115_1079714 3300048918 Bacteria 609
153 Ga0501291_042289 3300049514 Bacteria 805
154 Ga0501298_059636 3300049521 Bacteria 806
155 Ga0501036_0465933 3300049572 Bacteria 1052
156 Ga0501036_1357853 3300049572 Bacteria 577
157 Ga0501039_0105115 3300049575 Bacteria 2205
158 Ga0501042_0898893 3300049578 Bacteria 645
159 Ga0501048_0702087 3300049582 Bacteria 726
160 Ga0501067_0000954 3300049583 Bacteria 15495
161 Ga0501068_0025305 3300049584 Bacteria 3491
162 Ga0501071_0443932 3300049587 Bacteria 993
163 Ga0501072_0212630 3300049588 Bacteria 1541
164 Ga0501072_1443773 3300049588 Bacteria 532
165 Ga0501073_1032049 3300049589 Bacteria 566
166 Ga0501075_0093053 3300049591 Bacteria 2289
167 Ga0501076_0134888 3300049592 Bacteria 2004
168 Ga0501044_0992412 3300049823 Bacteria 712
169 Ga0501045_0031642 3300049824 Bacteria 3832
170 nmdc:mga08y16_891098_c1 3300050511 Bacteria 876
171 Ga0495612_0278657 3300053078 Bacteria 747
172 Ga0495655_0115519 3300053083 Bacteria 811
173 Ga0495619_0514523 3300053085 Bacteria 823
174 Ga0500593_000191 3300053117 Bacteria 24934
175 Ga0530510_0111467 3300061734 Bacteria 2004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10796421 Ga0207647_107964211 124
2 3300025942 Ga0207689_10951009 Ga0207689_109510092 124
3 3300048905 Ga0496102_1589256 Ga0496102_1589256_185_562 124
4 3300049589 Ga0501073_1032049 Ga0501073_1032049_43_417 124
5 iso_pu_bacteria 2626541554 2626635099 124
6 iso_pu_bacteria 8054609563 8054610022 125
7 3300013105 Ga0157369_10517854 Ga0157369_105178542 126
8 3300031241 Ga0265325_10224157 Ga0265325_102241572 126
9 3300031595 Ga0265313_10065189 Ga0265313_100651893 126
10 iso_pu_bacteria 2527291627 2528203278 126
11 iso_pu_bacteria 2527291629 2528214367 126
12 iso_pu_bacteria 2546825537 2546947923 126
13 iso_pu_bacteria 2576861822 2579749738 126
14 iso_pu_bacteria 2579778521 2579852385 126
15 iso_pu_bacteria 2619618881 2619855694 126
16 iso_pu_bacteria 2619619003 2620348143 126
17 iso_pu_bacteria 2684623036 2686541593 126
18 iso_pu_bacteria 2710264753 2710605280 126
19 iso_pu_bacteria 2773857924 2774864396 126
20 iso_pu_bacteria 637000116 637879726 126
21 iso_pu_bacteria 8054913762 8054916523 126
22 3300005330 Ga0070690_100616950 Ga0070690_1006169501 128
23 3300006038 Ga0075365_10026898 Ga0075365_100268984 128
24 3300006038 Ga0075365_10081839 Ga0075365_100818393 128
25 3300009098 Ga0105245_10307721 Ga0105245_103077213 128
26 3300009551 Ga0105238_11895617 Ga0105238_118956171 128
27 3300014326 Ga0157380_11448850 Ga0157380_114488501 128
28 3300044901 Ga0466960_0192628 Ga0466960_0192628_582_968 128
29 3300048904 Ga0496101_0061716 Ga0496101_0061716_306_692 128
30 3300048905 Ga0496102_0147744 Ga0496102_0147744_288_674 128
31 3300048909 Ga0496106_0191761 Ga0496106_0191761_1077_1463 128
32 3300048910 Ga0496107_0232518 Ga0496107_0232518_24_410 128
33 3300048912 Ga0496109_0922663 Ga0496109_0922663_226_612 128
34 3300003316 rootH1_10126366 rootH1_101263662 129
35 3300005327 Ga0070658_10942107 Ga0070658_109421072 129
36 3300005329 Ga0070683_100010493 Ga0070683_1000104937 129
37 3300005329 Ga0070683_100016543 Ga0070683_1000165432 129
38 3300005329 Ga0070683_100782924 Ga0070683_1007829241 129
39 3300005334 Ga0068869_101201089 Ga0068869_1012010891 129
40 3300005336 Ga0070680_100289944 Ga0070680_1002899442 129
41 3300005336 Ga0070680_100374951 Ga0070680_1003749512 129
42 3300005341 Ga0070691_10619059 Ga0070691_106190592 129
43 3300005344 Ga0070661_100989026 Ga0070661_1009890261 129
44 3300005347 Ga0070668_101237503 Ga0070668_1012375032 129
45 3300005366 Ga0070659_100559042 Ga0070659_1005590421 129
46 3300005366 Ga0070659_100803312 Ga0070659_1008033122 129
47 3300005445 Ga0070708_100248736 Ga0070708_1002487362 129
48 3300005455 Ga0070663_101690702 Ga0070663_1016907021 129
49 3300005455 Ga0070663_101919079 Ga0070663_1019190791 129
50 3300005535 Ga0070684_100534413 Ga0070684_1005344132 129
51 3300005563 Ga0068855_101873387 Ga0068855_1018733872 129
52 3300005577 Ga0068857_100021725 Ga0068857_1000217257 129
53 3300005578 Ga0068854_100148338 Ga0068854_1001483382 129
54 3300005615 Ga0070702_100887323 Ga0070702_1008873231 129
55 3300005718 Ga0068866_10460082 Ga0068866_104600822 129
56 3300005981 Ga0081538_10000308 Ga0081538_1000030812 129
57 3300006028 Ga0070717_10479098 Ga0070717_104790982 129
58 3300006163 Ga0070715_10076565 Ga0070715_100765652 129
59 3300006175 Ga0070712_100182221 Ga0070712_1001822212 129
60 3300006881 Ga0068865_100460039 Ga0068865_1004600392 129
61 3300009094 Ga0111539_10304176 Ga0111539_103041764 129
62 3300009094 Ga0111539_10567098 Ga0111539_105670982 129
63 3300009098 Ga0105245_12418755 Ga0105245_124187552 129
64 3300009545 Ga0105237_10565107 Ga0105237_105651072 129
65 3300009545 Ga0105237_10656131 Ga0105237_106561312 129
66 3300010375 Ga0105239_11111814 Ga0105239_111118142 129
67 3300010375 Ga0105239_11421141 Ga0105239_114211412 129
68 3300013105 Ga0157369_10944496 Ga0157369_109444962 129
69 3300013306 Ga0163162_10248413 Ga0163162_102484132 129
70 3300013307 Ga0157372_10059918 Ga0157372_100599182 129
71 3300013307 Ga0157372_10887102 Ga0157372_108871021 129
72 3300013307 Ga0157372_11886155 Ga0157372_118861551 129
73 3300014497 Ga0182008_10047573 Ga0182008_100475732 129
74 3300014497 Ga0182008_10058701 Ga0182008_100587012 129
75 3300014497 Ga0182008_10117686 Ga0182008_101176862 129
76 3300014745 Ga0157377_10095379 Ga0157377_100953792 129
77 3300020070 Ga0206356_10216136 Ga0206356_102161362 129
78 3300020081 Ga0206354_10591087 Ga0206354_105910871 129
79 3300020082 Ga0206353_10039145 Ga0206353_100391452 129
80 3300020082 Ga0206353_10739497 Ga0206353_107394972 129
81 3300020082 Ga0206353_11695621 Ga0206353_116956214 129
82 3300025899 Ga0207642_10130433 Ga0207642_101304332 129
83 3300025900 Ga0207710_10000105 Ga0207710_1000010572 129
84 3300025904 Ga0207647_10270573 Ga0207647_102705732 129
85 3300025912 Ga0207707_10668784 Ga0207707_106687842 129
86 3300025914 Ga0207671_10478623 Ga0207671_104786232 129
87 3300025915 Ga0207693_10814286 Ga0207693_108142862 129
88 3300025920 Ga0207649_10872321 Ga0207649_108723212 129
89 3300025921 Ga0207652_10558262 Ga0207652_105582622 129
90 3300025928 Ga0207700_10129835 Ga0207700_101298353 129
91 3300025932 Ga0207690_10722463 Ga0207690_107224632 129
92 3300025941 Ga0207711_10024820 Ga0207711_100248203 129
93 3300025944 Ga0207661_10016266 Ga0207661_100162665 129
94 3300025944 Ga0207661_10212999 Ga0207661_102129992 129
95 3300026078 Ga0207702_11446229 Ga0207702_114462292 129
96 3300026116 Ga0207674_10038490 Ga0207674_100384902 129
97 3300026142 Ga0207698_12075272 Ga0207698_120752722 129
98 3300031251 Ga0265327_10322104 Ga0265327_103221042 129
99 3300031548 Ga0307408_101725348 Ga0307408_1017253481 129
100 3300031852 Ga0307410_10102810 Ga0307410_101028102 129
101 3300031901 Ga0307406_10219894 Ga0307406_102198942 129
102 3300031901 Ga0307406_10380421 Ga0307406_103804212 129
103 3300031901 Ga0307406_10808332 Ga0307406_108083321 129
104 3300031903 Ga0307407_10051776 Ga0307407_100517762 129
105 3300031903 Ga0307407_10791096 Ga0307407_107910962 129
106 3300031911 Ga0307412_10153960 Ga0307412_101539602 129
107 3300031911 Ga0307412_10436374 Ga0307412_104363742 129
108 3300031911 Ga0307412_10579435 Ga0307412_105794352 129
109 3300031995 Ga0307409_100006548 Ga0307409_1000065485 129
110 3300031995 Ga0307409_100011353 Ga0307409_1000113533 129
111 3300031995 Ga0307409_100658126 Ga0307409_1006581262 129
112 3300031995 Ga0307409_100756004 Ga0307409_1007560042 129
113 3300032002 Ga0307416_100004779 Ga0307416_1000047798 129
114 3300032002 Ga0307416_100232692 Ga0307416_1002326922 129
115 3300032002 Ga0307416_100403171 Ga0307416_1004031712 129
116 3300032002 Ga0307416_100489940 Ga0307416_1004899402 129
117 3300032005 Ga0307411_10460193 Ga0307411_104601932 129
118 3300032005 Ga0307411_10807253 Ga0307411_108072531 129
119 3300032126 Ga0307415_100000214 Ga0307415_1000002148 129
120 3300035083 Ga0373926_0002485 Ga0373926_0002485_1266_1658 129
121 3300035171 Ga0373946_0028445 Ga0373946_0028445_1081_1473 129
122 3300035692 Ga0373935_0000341 Ga0373935_0000341_7913_8305 129
123 3300035725 Ga0373947_0001989 Ga0373947_0001989_6158_6550 129
124 3300037471 Ga0395905_0042417 Ga0395905_0042417_2508_2912 129
125 3300037471 Ga0395905_0247638 Ga0395905_0247638_467_877 129
126 3300038443 Ga0395901_0014942 Ga0395901_0014942_2258_2671 129
127 3300038443 Ga0395901_0839937 Ga0395901_0839937_246_635 129
128 3300038443 Ga0395901_2122456 Ga0395901_2122456_77_466 129
129 3300038996 Ga0242420_135655 Ga0242420_135655_141_530 129
130 3300041452 Ga0451793_0485574 Ga0451793_0485574_42_431 129
131 3300041453 Ga0451797_0279336 Ga0451797_0279336_367_756 129
132 3300041456 Ga0451795_0002929 Ga0451795_0002929_95_484 129
133 3300041494 Ga0451837_1412387 Ga0451837_1412387_286_678 129
134 3300041494 Ga0451837_1519674 Ga0451837_1519674_10_414 129
135 3300041509 Ga0451843_0520519 Ga0451843_0520519_491_895 129
136 3300041509 Ga0451843_0852152 Ga0451843_0852152_92_484 129
137 3300042014 Ga0439457_015733 Ga0439457_015733_990_1385 129
138 3300042145 Ga0450906_021998 Ga0450906_021998_103_498 129
139 3300042156 Ga0439446_0011114 Ga0439446_0011114_798_1193 129
140 3300042435 Ga0439434_0033585 Ga0439434_0033585_887_1282 129
141 3300044693 Ga0466961_0235050 Ga0466961_0235050_169_558 129
142 3300044694 Ga0466963_0182041 Ga0466963_0182041_329_721 129
143 3300044694 Ga0466963_0241314 Ga0466963_0241314_147_536 129
144 3300044765 Ga0466970_0037292 Ga0466970_0037292_16_408 129
145 3300044765 Ga0466970_0495177 Ga0466970_0495177_115_513 129
146 3300044901 Ga0466960_0050388 Ga0466960_0050388_108_497 129
147 3300044901 Ga0466960_0059015 Ga0466960_0059015_66_455 129
148 3300044901 Ga0466960_0434848 Ga0466960_0434848_221_616 129
149 3300044901 Ga0466960_0490096 Ga0466960_0490096_233_625 129
150 3300045976 Ga0466967_0042421 Ga0466967_0042421_47_436 129
151 3300045976 Ga0466967_0101387 Ga0466967_0101387_484_882 129
152 3300045976 Ga0466967_0563428 Ga0466967_0563428_444_839 129
153 3300045976 Ga0466967_0579005 Ga0466967_0579005_130_522 129
154 3300045976 Ga0466967_1051591 Ga0466967_1051591_102_494 129
155 3300045976 Ga0466967_1328582 Ga0466967_1328582_220_609 129
156 3300046477 Ga0495664_0036577 Ga0495664_0036577_352_744 129
157 3300046511 Ga0495608_0608086 Ga0495608_0608086_47_436 129
158 3300047319 Ga0495674_0071366 Ga0495674_0071366_436_828 129
159 3300047321 Ga0495676_0556795 Ga0495676_0556795_179_571 129
160 3300048903 Ga0496100_1657165 Ga0496100_1657165_62_454 129
161 3300048907 Ga0496104_0850620 Ga0496104_0850620_44_433 129
162 3300048912 Ga0496109_0408152 Ga0496109_0408152_879_1268 129
163 3300048912 Ga0496109_1522517 Ga0496109_1522517_122_514 129
164 3300048914 Ga0496111_0591892 Ga0496111_0591892_404_793 129
165 3300048914 Ga0496111_0979707 Ga0496111_0979707_175_570 129
166 3300048918 Ga0496115_0422513 Ga0496115_0422513_602_997 129
167 3300048918 Ga0496115_1079714 Ga0496115_1079714_142_537 129
168 3300049514 Ga0501291_042289 Ga0501291_042289_304_771 129
169 3300049521 Ga0501298_059636 Ga0501298_059636_352_741 129
170 3300049572 Ga0501036_0465933 Ga0501036_0465933_552_944 129
171 3300049572 Ga0501036_1357853 Ga0501036_1357853_163_555 129
172 3300049575 Ga0501039_0105115 Ga0501039_0105115_1492_1884 129
173 3300049578 Ga0501042_0898893 Ga0501042_0898893_115_525 129
174 3300049582 Ga0501048_0702087 Ga0501048_0702087_281_673 129
175 3300049583 Ga0501067_0000954 Ga0501067_0000954_4695_5084 129
176 3300049584 Ga0501068_0025305 Ga0501068_0025305_2551_2940 129
177 3300049587 Ga0501071_0443932 Ga0501071_0443932_463_855 129
178 3300049588 Ga0501072_0212630 Ga0501072_0212630_28_420 129
179 3300049588 Ga0501072_1443773 Ga0501072_1443773_56_448 129
180 3300049591 Ga0501075_0093053 Ga0501075_0093053_182_574 129
181 3300049592 Ga0501076_0134888 Ga0501076_0134888_59_451 129
182 3300049823 Ga0501044_0992412 Ga0501044_0992412_207_599 129
183 3300049824 Ga0501045_0031642 Ga0501045_0031642_331_723 129
184 3300050511 nmdc:mga08y16_891098_c1 nmdc:mga08y16_891098_c1_70_459 129
185 3300053078 Ga0495612_0278657 Ga0495612_0278657_296_688 129
186 3300053083 Ga0495655_0115519 Ga0495655_0115519_21_413 129
187 3300053085 Ga0495619_0514523 Ga0495619_0514523_363_755 129
188 3300053117 Ga0500593_000191 Ga0500593_000191_11657_12046 129
189 3300061734 Ga0530510_0111467 Ga0530510_0111467_273_662 129
190 iso_pu_bacteria 2811994874 2812331378 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

30

144

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9916 4 120
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.975 4 120
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8545 1 119
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8407 1 119
2lq3-assembly1.cif.gz_A solution nmr structure of syc0711_d from synechococcus sp., northeast structural genomics consortium (nesg) target snr212 0.5178 4 121
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9879 4 120 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9708 4 120 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8787 5 119 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8497 5 119 3.30.56.110
2lq3A01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.6624 47 118 1.10.1660.80
ID Description Score Start End GO Terms
AF-A0A2V6DHX8-F1-model_v4 DUF2237 domain-containing protein 1.01 78 119
AF-A0A348WHA5-F1-model_v4 DUF2237 domain-containing protein 1.007 70 118
AF-A0A2V5VJH0-F1-model_v4 DUF2237 domain-containing protein 1.005 70 119
AF-K5BGS2-F1-model_v4 DUF2237 domain-containing protein 1.001 20 86
AF-A0A2Z5TJP8-F1-model_v4 deleted 1 1 107

Feature Viewer

pLDDT pTM Quality
89.34 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map